Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T8Q6

Protein Details
Accession A0A1B7T8Q6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-31TNSLKQKKIKSDQWLKKIAKHydrophilic
NLS Segment(s)
PositionSequence
27-33KKIAKNR
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013272  Vps72/YL1_C  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MEKEDIFKHIATNSLKQKKIKSDQWLKKIAKNRHIPITRKWNKPVRQLLNSNTSNGKDIKNYYKIIPPYKGFYYPCMKLCDITGLPTVFTNAKMFGIRYYNSEVYEFIENYISAYDIEMYVKLREGTWEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.55
4 0.6
5 0.63
6 0.69
7 0.69
8 0.69
9 0.71
10 0.75
11 0.79
12 0.82
13 0.75
14 0.72
15 0.74
16 0.72
17 0.7
18 0.7
19 0.67
20 0.67
21 0.72
22 0.69
23 0.68
24 0.71
25 0.71
26 0.68
27 0.71
28 0.7
29 0.69
30 0.75
31 0.76
32 0.72
33 0.7
34 0.69
35 0.65
36 0.64
37 0.59
38 0.51
39 0.43
40 0.35
41 0.3
42 0.27
43 0.23
44 0.17
45 0.19
46 0.23
47 0.26
48 0.26
49 0.26
50 0.29
51 0.32
52 0.34
53 0.34
54 0.29
55 0.29
56 0.29
57 0.32
58 0.27
59 0.28
60 0.29
61 0.29
62 0.31
63 0.31
64 0.29
65 0.26
66 0.26
67 0.26
68 0.21
69 0.2
70 0.2
71 0.16
72 0.16
73 0.16
74 0.17
75 0.12
76 0.13
77 0.12
78 0.09
79 0.1
80 0.11
81 0.11
82 0.12
83 0.16
84 0.15
85 0.17
86 0.23
87 0.24
88 0.24
89 0.24
90 0.22
91 0.21
92 0.24
93 0.21
94 0.16
95 0.15
96 0.14
97 0.14
98 0.14
99 0.12
100 0.08
101 0.08
102 0.08
103 0.07
104 0.08
105 0.09
106 0.1
107 0.11
108 0.13
109 0.13
110 0.12