Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T7V9

Protein Details
Accession A0A1B7T7V9    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
85-128QFPNHLRQRPLQSQNKKKVENKRLLTWKTVKKKMKISYTPRKLSHydrophilic
NLS Segment(s)
PositionSequence
102-102K
105-107NKR
111-119WKTVKKKMK
Subcellular Location(s) mito 13, nucl 5, plas 3, cyto 2, extr 2
Family & Domain DBs
Amino Acid Sequences MTKHLLLKLPNQLLISAIPTLLGQTLLAKLDLEILPAFLLERRMKTKLLILLKLTNLILLSTYLLTKTRQHQHLLLQLQQPHLVQFPNHLRQRPLQSQNKKKVENKRLLTWKTVKKKMKISYTPRKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.15
4 0.12
5 0.09
6 0.08
7 0.09
8 0.08
9 0.07
10 0.05
11 0.06
12 0.07
13 0.08
14 0.08
15 0.07
16 0.07
17 0.11
18 0.11
19 0.11
20 0.1
21 0.09
22 0.09
23 0.09
24 0.09
25 0.06
26 0.11
27 0.12
28 0.15
29 0.18
30 0.21
31 0.22
32 0.22
33 0.26
34 0.27
35 0.3
36 0.29
37 0.27
38 0.28
39 0.28
40 0.28
41 0.24
42 0.17
43 0.13
44 0.1
45 0.08
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.07
53 0.1
54 0.16
55 0.23
56 0.26
57 0.28
58 0.3
59 0.33
60 0.39
61 0.39
62 0.37
63 0.33
64 0.32
65 0.31
66 0.3
67 0.26
68 0.2
69 0.19
70 0.15
71 0.11
72 0.16
73 0.22
74 0.3
75 0.34
76 0.36
77 0.37
78 0.42
79 0.51
80 0.54
81 0.56
82 0.58
83 0.64
84 0.72
85 0.81
86 0.84
87 0.83
88 0.81
89 0.83
90 0.83
91 0.82
92 0.77
93 0.77
94 0.78
95 0.73
96 0.74
97 0.72
98 0.72
99 0.72
100 0.76
101 0.75
102 0.73
103 0.8
104 0.8
105 0.82
106 0.82
107 0.82
108 0.83