Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T7P7

Protein Details
Accession A0A1B7T7P7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-35IANNKIASAKPLKKRPNNKPINNKVDNKNSNPHydrophilic
NLS Segment(s)
PositionSequence
14-20PLKKRPN
Subcellular Location(s) nucl 16.5, mito_nucl 12.666, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045107  SAC3/GANP/THP3  
IPR005062  SAC3/GANP/THP3_conserved  
Pfam View protein in Pfam  
PF03399  SAC3_GANP  
Amino Acid Sequences MPTIANNKIASAKPLKKRPNNKPINNKVDNKNSNPKSKNINPNNNVPNNTTNFEINLGYENFPFDLYNTRPLSNTSVDKSTKKYKTPIEIPKFMVKKKLTITPKLFKQNTWDLANQESLKNLEDSKKNGNITTQGLYDQFKARRDKERLKLEQLKLVDKADTSKHLNDAINFQGSCLEMCPVFERIRRELENNVSHLEKENNFASPDKAIKAFARPAASAPPPLPSDVRPPNVLVKALNYIVDNILQTLPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.67
3 0.72
4 0.82
5 0.86
6 0.88
7 0.9
8 0.91
9 0.92
10 0.92
11 0.92
12 0.9
13 0.87
14 0.84
15 0.84
16 0.81
17 0.77
18 0.78
19 0.74
20 0.76
21 0.71
22 0.68
23 0.66
24 0.69
25 0.72
26 0.72
27 0.76
28 0.69
29 0.76
30 0.8
31 0.76
32 0.69
33 0.62
34 0.56
35 0.49
36 0.47
37 0.39
38 0.31
39 0.26
40 0.25
41 0.21
42 0.16
43 0.16
44 0.15
45 0.15
46 0.14
47 0.14
48 0.13
49 0.13
50 0.12
51 0.1
52 0.14
53 0.15
54 0.22
55 0.24
56 0.24
57 0.24
58 0.26
59 0.29
60 0.28
61 0.29
62 0.24
63 0.28
64 0.3
65 0.32
66 0.35
67 0.41
68 0.43
69 0.43
70 0.47
71 0.48
72 0.53
73 0.6
74 0.65
75 0.63
76 0.62
77 0.61
78 0.63
79 0.61
80 0.53
81 0.52
82 0.42
83 0.4
84 0.38
85 0.43
86 0.4
87 0.45
88 0.51
89 0.5
90 0.55
91 0.6
92 0.58
93 0.5
94 0.51
95 0.49
96 0.47
97 0.43
98 0.38
99 0.3
100 0.3
101 0.33
102 0.28
103 0.21
104 0.16
105 0.14
106 0.13
107 0.12
108 0.12
109 0.14
110 0.15
111 0.18
112 0.22
113 0.25
114 0.25
115 0.25
116 0.25
117 0.23
118 0.23
119 0.21
120 0.17
121 0.13
122 0.14
123 0.15
124 0.15
125 0.18
126 0.18
127 0.22
128 0.27
129 0.3
130 0.38
131 0.45
132 0.52
133 0.56
134 0.64
135 0.63
136 0.67
137 0.72
138 0.65
139 0.62
140 0.55
141 0.49
142 0.4
143 0.36
144 0.28
145 0.19
146 0.2
147 0.16
148 0.19
149 0.2
150 0.19
151 0.2
152 0.23
153 0.24
154 0.23
155 0.24
156 0.22
157 0.22
158 0.21
159 0.19
160 0.17
161 0.16
162 0.15
163 0.12
164 0.11
165 0.07
166 0.08
167 0.1
168 0.12
169 0.14
170 0.17
171 0.21
172 0.24
173 0.3
174 0.32
175 0.32
176 0.35
177 0.41
178 0.42
179 0.39
180 0.39
181 0.33
182 0.31
183 0.32
184 0.3
185 0.23
186 0.23
187 0.22
188 0.21
189 0.22
190 0.23
191 0.22
192 0.21
193 0.22
194 0.21
195 0.2
196 0.21
197 0.21
198 0.26
199 0.28
200 0.29
201 0.3
202 0.28
203 0.29
204 0.32
205 0.33
206 0.31
207 0.27
208 0.27
209 0.25
210 0.27
211 0.27
212 0.23
213 0.31
214 0.35
215 0.39
216 0.36
217 0.38
218 0.43
219 0.43
220 0.43
221 0.34
222 0.29
223 0.3
224 0.29
225 0.28
226 0.21
227 0.2
228 0.19
229 0.2
230 0.17
231 0.14
232 0.14