Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TD56

Protein Details
Accession A0A1B7TD56    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-36NSHAEPTKVKKIKQKKKKDPNAPKRGLSAHydrophilic
NLS Segment(s)
PositionSequence
14-32TKVKKIKQKKKKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAEDKKVNSHAEPTKVKKIKQKKKKDPNAPKRGLSAYMIFANENRDRVRAENEGITFGQVGKKLGEEWKALTEDGKQKYKDLAEVEKKRYESEKALYLATK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.64
4 0.66
5 0.71
6 0.74
7 0.77
8 0.81
9 0.82
10 0.88
11 0.93
12 0.95
13 0.95
14 0.95
15 0.95
16 0.9
17 0.81
18 0.73
19 0.65
20 0.55
21 0.46
22 0.36
23 0.27
24 0.23
25 0.21
26 0.17
27 0.15
28 0.18
29 0.17
30 0.18
31 0.16
32 0.15
33 0.16
34 0.17
35 0.2
36 0.17
37 0.17
38 0.18
39 0.17
40 0.18
41 0.17
42 0.16
43 0.12
44 0.1
45 0.11
46 0.09
47 0.1
48 0.08
49 0.09
50 0.1
51 0.13
52 0.16
53 0.15
54 0.16
55 0.18
56 0.19
57 0.18
58 0.18
59 0.2
60 0.25
61 0.3
62 0.35
63 0.32
64 0.33
65 0.37
66 0.38
67 0.37
68 0.34
69 0.38
70 0.42
71 0.49
72 0.54
73 0.55
74 0.55
75 0.54
76 0.53
77 0.48
78 0.44
79 0.41
80 0.42
81 0.38