Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TH35

Protein Details
Accession A0A1B7TH35    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKFKYYKGIRRLKHRVSGKNNNSSKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 11.333, cyto_nucl 9.166, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007143  Vps28  
IPR017899  VPS28_C  
IPR037206  VPS28_C_sf  
Gene Ontology GO:0000813  C:ESCRT I complex  
GO:0032509  P:endosome transport via multivesicular body sorting pathway  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03997  VPS28  
PROSITE View protein in PROSITE  
PS51310  VPS28_C  
Amino Acid Sequences MKFKYYKGIRRLKHRVSGKNNNSSKSKASESLIFNTNAKLISEVTGNFITIMDALNLNYDKKHQIHPLLSKLVLNLNKVMGDFKENRQLLVDWLVFLNQMNSSDSISKEDGKKLLFDLETAYNKFYDLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.81
4 0.85
5 0.83
6 0.83
7 0.8
8 0.75
9 0.7
10 0.63
11 0.57
12 0.51
13 0.46
14 0.39
15 0.37
16 0.38
17 0.38
18 0.38
19 0.37
20 0.34
21 0.3
22 0.27
23 0.25
24 0.19
25 0.16
26 0.13
27 0.1
28 0.09
29 0.1
30 0.1
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.11
48 0.13
49 0.17
50 0.19
51 0.22
52 0.27
53 0.3
54 0.33
55 0.31
56 0.3
57 0.26
58 0.23
59 0.25
60 0.22
61 0.19
62 0.15
63 0.14
64 0.14
65 0.14
66 0.14
67 0.09
68 0.12
69 0.14
70 0.16
71 0.25
72 0.24
73 0.24
74 0.25
75 0.25
76 0.22
77 0.25
78 0.23
79 0.14
80 0.14
81 0.14
82 0.12
83 0.12
84 0.11
85 0.07
86 0.08
87 0.09
88 0.1
89 0.11
90 0.13
91 0.14
92 0.17
93 0.18
94 0.22
95 0.23
96 0.26
97 0.28
98 0.27
99 0.27
100 0.25
101 0.28
102 0.24
103 0.21
104 0.21
105 0.25
106 0.29
107 0.29
108 0.29
109 0.24
110 0.24