Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TCX7

Protein Details
Accession A0A1B7TCX7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
311-331NKNNNREKKDEDKKNENKTPSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 8, E.R. 6, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007704  PIG-M  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0051751  F:alpha-1,4-mannosyltransferase activity  
GO:0004376  F:glycolipid mannosyltransferase activity  
GO:0071555  P:cell wall organization  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF05007  Mannosyl_trans  
Amino Acid Sequences MSLVNIKNLFAVGILIRLIFFIYGVIQDSISIIKYTDVDYYVFLDSFQYLWNEEGGSPYQRDTFRYTPLLSYLMLPTQLNIHLGKVLFVIFDLLTAFYIYKLLKKYYNKNNDSLVLVGTAIWLLNPMVITISTRGNAESIMSFLIMLFLYLLDKEDFILSGIVYGLSIHFKIYPIIYCIPISVYFLFVADRKNSKNIKSLIKFALASVVSLFCITYLVYLKFGNEFLEHTYFYHLVRSDHRHNFSIWNMVLYMEQMPSLIETNLKQVFIENSEKSRFKLNYKIILDNKKLSTLPQMLICFIIPSVILIKTNKNNNREKKDEDKKNENKTPSFITLIQVITIQTMLFVHFNKVITSQYFVWYLTFVPFFIQHFAFLYNHCKIKLIVLPLVWILSQAIWLYFGYLLEFKNQNCFVGLFFAGCLMLLGNVYVIGELITAIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.09
6 0.07
7 0.06
8 0.05
9 0.06
10 0.06
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.11
17 0.11
18 0.1
19 0.08
20 0.09
21 0.1
22 0.12
23 0.13
24 0.13
25 0.13
26 0.14
27 0.16
28 0.17
29 0.16
30 0.14
31 0.13
32 0.12
33 0.12
34 0.13
35 0.11
36 0.11
37 0.12
38 0.12
39 0.12
40 0.12
41 0.14
42 0.15
43 0.17
44 0.17
45 0.18
46 0.23
47 0.23
48 0.26
49 0.31
50 0.32
51 0.34
52 0.38
53 0.38
54 0.33
55 0.34
56 0.33
57 0.26
58 0.24
59 0.21
60 0.17
61 0.17
62 0.16
63 0.14
64 0.15
65 0.15
66 0.15
67 0.14
68 0.13
69 0.14
70 0.14
71 0.15
72 0.13
73 0.12
74 0.09
75 0.09
76 0.1
77 0.06
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.06
85 0.08
86 0.08
87 0.12
88 0.15
89 0.18
90 0.25
91 0.32
92 0.42
93 0.5
94 0.61
95 0.61
96 0.62
97 0.62
98 0.57
99 0.51
100 0.42
101 0.32
102 0.21
103 0.17
104 0.13
105 0.09
106 0.07
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.04
114 0.05
115 0.05
116 0.06
117 0.07
118 0.09
119 0.09
120 0.09
121 0.1
122 0.09
123 0.09
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.06
132 0.05
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.06
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.07
159 0.08
160 0.09
161 0.11
162 0.12
163 0.13
164 0.12
165 0.12
166 0.13
167 0.12
168 0.13
169 0.1
170 0.1
171 0.08
172 0.09
173 0.09
174 0.09
175 0.11
176 0.12
177 0.15
178 0.15
179 0.23
180 0.26
181 0.28
182 0.34
183 0.37
184 0.43
185 0.42
186 0.46
187 0.41
188 0.39
189 0.37
190 0.29
191 0.29
192 0.2
193 0.17
194 0.13
195 0.11
196 0.09
197 0.08
198 0.08
199 0.04
200 0.04
201 0.04
202 0.04
203 0.06
204 0.07
205 0.08
206 0.08
207 0.08
208 0.09
209 0.09
210 0.09
211 0.07
212 0.08
213 0.09
214 0.11
215 0.11
216 0.1
217 0.13
218 0.12
219 0.12
220 0.14
221 0.13
222 0.13
223 0.17
224 0.23
225 0.29
226 0.35
227 0.38
228 0.37
229 0.37
230 0.38
231 0.35
232 0.34
233 0.26
234 0.2
235 0.17
236 0.16
237 0.15
238 0.13
239 0.13
240 0.06
241 0.06
242 0.06
243 0.05
244 0.06
245 0.07
246 0.06
247 0.06
248 0.07
249 0.12
250 0.13
251 0.13
252 0.12
253 0.12
254 0.13
255 0.16
256 0.21
257 0.17
258 0.2
259 0.25
260 0.26
261 0.26
262 0.32
263 0.31
264 0.29
265 0.37
266 0.39
267 0.44
268 0.46
269 0.53
270 0.52
271 0.58
272 0.57
273 0.53
274 0.48
275 0.42
276 0.38
277 0.32
278 0.32
279 0.27
280 0.26
281 0.25
282 0.25
283 0.22
284 0.23
285 0.22
286 0.15
287 0.11
288 0.1
289 0.05
290 0.05
291 0.07
292 0.07
293 0.09
294 0.1
295 0.16
296 0.22
297 0.31
298 0.37
299 0.43
300 0.53
301 0.61
302 0.67
303 0.68
304 0.69
305 0.7
306 0.75
307 0.77
308 0.76
309 0.77
310 0.78
311 0.82
312 0.83
313 0.79
314 0.7
315 0.64
316 0.6
317 0.52
318 0.47
319 0.38
320 0.32
321 0.29
322 0.27
323 0.23
324 0.18
325 0.15
326 0.12
327 0.11
328 0.09
329 0.06
330 0.06
331 0.07
332 0.08
333 0.09
334 0.11
335 0.14
336 0.14
337 0.15
338 0.16
339 0.17
340 0.16
341 0.2
342 0.18
343 0.19
344 0.19
345 0.19
346 0.18
347 0.16
348 0.16
349 0.14
350 0.14
351 0.11
352 0.12
353 0.13
354 0.14
355 0.17
356 0.16
357 0.14
358 0.15
359 0.17
360 0.17
361 0.17
362 0.23
363 0.24
364 0.27
365 0.26
366 0.27
367 0.25
368 0.3
369 0.32
370 0.31
371 0.29
372 0.26
373 0.27
374 0.26
375 0.26
376 0.2
377 0.15
378 0.11
379 0.08
380 0.09
381 0.08
382 0.07
383 0.08
384 0.08
385 0.09
386 0.09
387 0.09
388 0.1
389 0.12
390 0.12
391 0.17
392 0.21
393 0.2
394 0.28
395 0.29
396 0.27
397 0.27
398 0.27
399 0.22
400 0.22
401 0.22
402 0.14
403 0.13
404 0.13
405 0.11
406 0.1
407 0.1
408 0.06
409 0.06
410 0.05
411 0.05
412 0.05
413 0.05
414 0.05
415 0.05
416 0.05
417 0.04
418 0.04