Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TFL8

Protein Details
Accession A0A1B7TFL8   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23VSLQVARRRKRRKDQYVPEISELHydrophilic
NLS Segment(s)
PositionSequence
7-13RRRKRRK
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001210  Ribosomal_S17e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00833  Ribosomal_S17e  
Amino Acid Sequences VSLQVARRRKRRKDQYVPEISELDLKRSNGVINVDRQTEDMIKSLGLKLPISVTNISANRKFRKRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.93
4 0.86
5 0.78
6 0.67
7 0.56
8 0.51
9 0.41
10 0.34
11 0.26
12 0.22
13 0.21
14 0.2
15 0.2
16 0.15
17 0.18
18 0.16
19 0.17
20 0.19
21 0.18
22 0.18
23 0.18
24 0.17
25 0.15
26 0.14
27 0.11
28 0.1
29 0.09
30 0.1
31 0.11
32 0.11
33 0.12
34 0.11
35 0.1
36 0.13
37 0.15
38 0.17
39 0.16
40 0.16
41 0.22
42 0.25
43 0.3
44 0.34
45 0.4
46 0.47