Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TC64

Protein Details
Accession A0A1B7TC64    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKKRASNGRNKKGRGHVNPBasic
82-111RIVRVRSRENRKIRAPPRRPRFNRTGDNKVBasic
NLS Segment(s)
PositionSequence
3-15KKRASNGRNKKGR
86-103VRSRENRKIRAPPRRPRF
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVNPVRCMNCSKSVPKDKAIKRVQIKNIVENAAIRDLSEASVYNEYALPKTYVKNHYCVSCAIHARIVRVRSRENRKIRAPPRRPRFNRTGDNKVSADGAAAAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.77
4 0.74
5 0.73
6 0.77
7 0.76
8 0.69
9 0.6
10 0.56
11 0.5
12 0.49
13 0.45
14 0.43
15 0.46
16 0.53
17 0.55
18 0.58
19 0.64
20 0.61
21 0.66
22 0.67
23 0.66
24 0.64
25 0.69
26 0.68
27 0.68
28 0.65
29 0.6
30 0.57
31 0.49
32 0.41
33 0.33
34 0.28
35 0.2
36 0.18
37 0.12
38 0.1
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.11
54 0.17
55 0.24
56 0.25
57 0.29
58 0.3
59 0.3
60 0.3
61 0.3
62 0.27
63 0.24
64 0.24
65 0.21
66 0.23
67 0.23
68 0.24
69 0.28
70 0.29
71 0.28
72 0.3
73 0.36
74 0.42
75 0.51
76 0.58
77 0.63
78 0.68
79 0.71
80 0.78
81 0.8
82 0.82
83 0.82
84 0.83
85 0.85
86 0.88
87 0.87
88 0.84
89 0.84
90 0.83
91 0.83
92 0.8
93 0.8
94 0.74
95 0.74
96 0.66
97 0.57
98 0.48
99 0.38
100 0.3
101 0.2