Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TK47

Protein Details
Accession A0A1B7TK47   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-66TQPTTKQDKVKAKKKNNNPKQKKKQNKKLPTNNQSTEHydrophilic
76-111KDDGNEKKNDKKPNNNKKKKKNNNTKSKQKATTPVPHydrophilic
NLS Segment(s)
PositionSequence
38-57KVKAKKKNNNPKQKKKQNKK
82-103KKNDKKPNNNKKKKKNNNTKSK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKILLDKAVKAGLLSKETAEKQQLLNANLTQPTTKQDKVKAKKKNNNPKQKKKQNKKLPTNNQSTESLDEKKLVTKDDGNEKKNDKKPNNNKKKKKNNNTKSKQKATTPVPNTPEDKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.23
4 0.25
5 0.29
6 0.27
7 0.25
8 0.24
9 0.28
10 0.32
11 0.29
12 0.3
13 0.27
14 0.26
15 0.25
16 0.25
17 0.2
18 0.16
19 0.19
20 0.21
21 0.24
22 0.25
23 0.33
24 0.43
25 0.52
26 0.6
27 0.67
28 0.72
29 0.78
30 0.84
31 0.87
32 0.87
33 0.88
34 0.91
35 0.92
36 0.92
37 0.94
38 0.94
39 0.94
40 0.95
41 0.94
42 0.94
43 0.93
44 0.93
45 0.93
46 0.9
47 0.87
48 0.78
49 0.7
50 0.61
51 0.52
52 0.44
53 0.36
54 0.3
55 0.22
56 0.21
57 0.18
58 0.2
59 0.2
60 0.19
61 0.18
62 0.18
63 0.22
64 0.32
65 0.39
66 0.38
67 0.42
68 0.46
69 0.53
70 0.57
71 0.63
72 0.6
73 0.64
74 0.73
75 0.79
76 0.85
77 0.87
78 0.91
79 0.92
80 0.95
81 0.95
82 0.95
83 0.95
84 0.95
85 0.95
86 0.95
87 0.95
88 0.94
89 0.92
90 0.88
91 0.83
92 0.81
93 0.79
94 0.79
95 0.74
96 0.72
97 0.66
98 0.65