Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YUE4

Protein Details
Accession C7YUE4    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-41GGALKLKGSKVHKKKKKRDKKTDLEKNLDABasic
NLS Segment(s)
PositionSequence
16-46KLKGSKVHKKKKKRDKKTDLEKNLDAGKREG
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG nhe:NECHADRAFT_84893  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MASDDYTAVGGGGALKLKGSKVHKKKKKRDKKTDLEKNLDAGKREGPDPDKKKEVDDEPRDEEDDRPAVQKTEAEKRHDEIKKKRLLQLAESSGSRPELLKTHKERVEELNTYLSRLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.09
5 0.16
6 0.23
7 0.33
8 0.43
9 0.55
10 0.64
11 0.75
12 0.85
13 0.89
14 0.93
15 0.94
16 0.94
17 0.94
18 0.95
19 0.95
20 0.95
21 0.93
22 0.89
23 0.78
24 0.7
25 0.65
26 0.56
27 0.47
28 0.37
29 0.32
30 0.26
31 0.25
32 0.25
33 0.23
34 0.31
35 0.35
36 0.38
37 0.4
38 0.39
39 0.4
40 0.41
41 0.43
42 0.43
43 0.43
44 0.43
45 0.42
46 0.43
47 0.42
48 0.39
49 0.33
50 0.25
51 0.21
52 0.16
53 0.13
54 0.13
55 0.12
56 0.11
57 0.14
58 0.15
59 0.23
60 0.27
61 0.3
62 0.31
63 0.33
64 0.42
65 0.45
66 0.5
67 0.5
68 0.54
69 0.58
70 0.6
71 0.64
72 0.6
73 0.57
74 0.54
75 0.52
76 0.48
77 0.42
78 0.39
79 0.34
80 0.29
81 0.27
82 0.22
83 0.15
84 0.12
85 0.16
86 0.21
87 0.3
88 0.35
89 0.43
90 0.46
91 0.48
92 0.49
93 0.5
94 0.53
95 0.46
96 0.42
97 0.41
98 0.38
99 0.37
100 0.35
101 0.27
102 0.21
103 0.19
104 0.22
105 0.2
106 0.23
107 0.28
108 0.35
109 0.35