Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TBI0

Protein Details
Accession A0A1B7TBI0    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-40INVPKTRKTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSLIVFLSFINVPKTRKTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQAGFGGQTKQIFHKKAKTTKKVVLKLECVECKTKAQLALKRCKHFELGGERKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.42
4 0.47
5 0.53
6 0.58
7 0.67
8 0.73
9 0.78
10 0.83
11 0.85
12 0.9
13 0.89
14 0.9
15 0.9
16 0.9
17 0.88
18 0.88
19 0.88
20 0.81
21 0.8
22 0.73
23 0.68
24 0.6
25 0.52
26 0.41
27 0.33
28 0.32
29 0.31
30 0.32
31 0.3
32 0.33
33 0.39
34 0.42
35 0.46
36 0.5
37 0.49
38 0.53
39 0.58
40 0.57
41 0.57
42 0.56
43 0.55
44 0.51
45 0.47
46 0.4
47 0.35
48 0.31
49 0.24
50 0.27
51 0.28
52 0.28
53 0.29
54 0.35
55 0.39
56 0.48
57 0.58
58 0.61
59 0.62
60 0.67
61 0.73
62 0.72
63 0.71
64 0.67
65 0.62
66 0.58
67 0.58
68 0.54
69 0.47
70 0.43
71 0.37
72 0.34
73 0.32
74 0.31
75 0.3
76 0.35
77 0.38
78 0.44
79 0.53
80 0.59
81 0.63
82 0.62
83 0.59
84 0.55
85 0.51
86 0.49
87 0.5
88 0.51
89 0.53
90 0.59
91 0.57
92 0.56
93 0.59
94 0.55