Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0W4E6

Protein Details
Accession G0W4E6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAEAKEPKRRVVRRKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
5-23KEPKRRVVRRKKDPNAPKR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG ndi:NDAI_0A05290  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAEAKEPKRRVVRRKKDPNAPKRGLSAYMFFANDNRDIVKAENPNITFGQIGKVLGAKWKELNDEEKQPYQDKADADKKRYESEKELYNATHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.91
4 0.93
5 0.92
6 0.91
7 0.85
8 0.76
9 0.7
10 0.63
11 0.55
12 0.46
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.1
24 0.11
25 0.12
26 0.16
27 0.16
28 0.17
29 0.21
30 0.21
31 0.22
32 0.21
33 0.21
34 0.16
35 0.13
36 0.13
37 0.09
38 0.09
39 0.07
40 0.08
41 0.07
42 0.11
43 0.12
44 0.11
45 0.13
46 0.14
47 0.17
48 0.18
49 0.24
50 0.24
51 0.31
52 0.34
53 0.35
54 0.37
55 0.36
56 0.36
57 0.34
58 0.34
59 0.28
60 0.32
61 0.38
62 0.42
63 0.45
64 0.5
65 0.5
66 0.53
67 0.56
68 0.53
69 0.5
70 0.49
71 0.53
72 0.49
73 0.49