Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7TFB3

Protein Details
Accession A0A1B7TFB3    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-39QTPKVDKQEKPKQPKGRAYKRILHydrophilic
NLS Segment(s)
PositionSequence
20-35KVDKQEKPKQPKGRAY
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MAKVHGSLSRAGKVKSQTPKVDKQEKPKQPKGRAYKRILYTRRFVNVTLVNGKRKMNSNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.49
4 0.51
5 0.54
6 0.63
7 0.67
8 0.73
9 0.7
10 0.71
11 0.74
12 0.75
13 0.78
14 0.78
15 0.79
16 0.76
17 0.81
18 0.81
19 0.81
20 0.81
21 0.78
22 0.77
23 0.74
24 0.76
25 0.73
26 0.67
27 0.61
28 0.57
29 0.56
30 0.5
31 0.43
32 0.4
33 0.38
34 0.39
35 0.42
36 0.41
37 0.42
38 0.44
39 0.45
40 0.43