Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TBV2

Protein Details
Accession A0A1B7TBV2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
157-182GFSFGKKSKAKYKKNVKLLQKKYEEIHydrophilic
NLS Segment(s)
PositionSequence
163-170KSKAKYKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MSSFLSNFKDSIVELRQAVNHHYADKDALADKQASIFAVNYKFWNYVYQYLWSKEITSYNDLVNHIQTDSAINSINWKRMYTIIIIVCVYSLFRTRLLKNYEKTKLDQMVDENKQAVWKELNKNKEKGVSEWDGDYNTEVSQENEDNEEEKNSNSTGFSFGKKSKAKYKKNVKLLQKKYEEIQLQKQLQQEQDDDDDLADIADLLED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.26
5 0.29
6 0.28
7 0.25
8 0.24
9 0.24
10 0.23
11 0.22
12 0.21
13 0.19
14 0.16
15 0.16
16 0.16
17 0.16
18 0.15
19 0.15
20 0.14
21 0.12
22 0.12
23 0.11
24 0.13
25 0.15
26 0.16
27 0.17
28 0.18
29 0.19
30 0.19
31 0.23
32 0.21
33 0.23
34 0.24
35 0.28
36 0.3
37 0.31
38 0.32
39 0.28
40 0.26
41 0.23
42 0.25
43 0.23
44 0.23
45 0.22
46 0.22
47 0.24
48 0.24
49 0.23
50 0.2
51 0.17
52 0.13
53 0.12
54 0.11
55 0.09
56 0.08
57 0.08
58 0.08
59 0.07
60 0.14
61 0.15
62 0.2
63 0.2
64 0.19
65 0.2
66 0.2
67 0.22
68 0.17
69 0.2
70 0.15
71 0.16
72 0.15
73 0.14
74 0.12
75 0.11
76 0.1
77 0.05
78 0.07
79 0.07
80 0.09
81 0.13
82 0.14
83 0.21
84 0.27
85 0.33
86 0.34
87 0.41
88 0.45
89 0.44
90 0.44
91 0.42
92 0.41
93 0.35
94 0.32
95 0.28
96 0.3
97 0.29
98 0.28
99 0.24
100 0.19
101 0.21
102 0.19
103 0.18
104 0.13
105 0.18
106 0.26
107 0.31
108 0.4
109 0.43
110 0.45
111 0.46
112 0.49
113 0.44
114 0.37
115 0.39
116 0.33
117 0.29
118 0.28
119 0.27
120 0.21
121 0.19
122 0.18
123 0.13
124 0.09
125 0.1
126 0.09
127 0.09
128 0.11
129 0.11
130 0.11
131 0.12
132 0.12
133 0.12
134 0.12
135 0.14
136 0.12
137 0.12
138 0.13
139 0.11
140 0.11
141 0.11
142 0.11
143 0.14
144 0.16
145 0.18
146 0.21
147 0.23
148 0.32
149 0.36
150 0.41
151 0.46
152 0.55
153 0.63
154 0.68
155 0.77
156 0.78
157 0.84
158 0.88
159 0.88
160 0.88
161 0.87
162 0.87
163 0.82
164 0.75
165 0.67
166 0.66
167 0.62
168 0.57
169 0.57
170 0.56
171 0.54
172 0.54
173 0.56
174 0.52
175 0.5
176 0.48
177 0.4
178 0.35
179 0.34
180 0.32
181 0.28
182 0.23
183 0.19
184 0.16
185 0.14
186 0.09
187 0.06