Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T8M3

Protein Details
Accession A0A1B7T8M3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
3-32ASIAHPKIVKKHTKKFKRHHSDRYHRVTEABasic
NLS Segment(s)
PositionSequence
9-24KIVKKHTKKFKRHHSD
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASIAHPKIVKKHTKKFKRHHSDRYHRVTEAWRKQKGIDSVVRRRFRGNISEPTIGYGSNKKTKFLSPSGHKTLLIANLKDLELLTMHTKTYAAEIAHNVSSKNRVEIVEKAKSLGIKITNPKGKLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.78
3 0.86
4 0.89
5 0.91
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.84
14 0.73
15 0.66
16 0.64
17 0.63
18 0.63
19 0.62
20 0.56
21 0.53
22 0.54
23 0.58
24 0.53
25 0.48
26 0.45
27 0.45
28 0.52
29 0.6
30 0.62
31 0.56
32 0.54
33 0.51
34 0.47
35 0.46
36 0.42
37 0.41
38 0.42
39 0.43
40 0.41
41 0.39
42 0.36
43 0.28
44 0.23
45 0.19
46 0.18
47 0.23
48 0.24
49 0.23
50 0.25
51 0.27
52 0.31
53 0.31
54 0.34
55 0.34
56 0.41
57 0.45
58 0.45
59 0.42
60 0.38
61 0.35
62 0.35
63 0.31
64 0.24
65 0.19
66 0.19
67 0.19
68 0.18
69 0.16
70 0.09
71 0.06
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.1
82 0.11
83 0.13
84 0.15
85 0.17
86 0.18
87 0.17
88 0.15
89 0.2
90 0.19
91 0.2
92 0.2
93 0.19
94 0.22
95 0.29
96 0.34
97 0.36
98 0.35
99 0.34
100 0.34
101 0.33
102 0.31
103 0.29
104 0.26
105 0.26
106 0.34
107 0.43
108 0.48
109 0.49
110 0.5
111 0.48