Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TEV8

Protein Details
Accession A0A1B7TEV8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
256-284HYQVYKKKPLLIKNKYKNKKTNKLELINFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
PROSITE View protein in PROSITE  
PS00973  USP_2  
PS50235  USP_3  
CDD cd02257  Peptidase_C19  
Amino Acid Sequences LFINISEIRHLERILGTSLLEQSDWLEILERIVVTLEKENHKINTTRLINNNNNNSNKNNNNNNGDKKLPELPFYGTLSTRSYCSICKNTARPNSKLMVENERKNSILIDMTTQDEYKNDTFEQILTRSLCDIVQDYTCSYCSIKRKIDKKDNVSNLTKRKFENGNIYINDDDVIDTESLTRNDLIKSNLVKINKFVKYPETLILSLNRFKCNYNGQFIRVNNIYCDFPKFLNFNGNNYRLNNLVKHSGGVRTGGHYQVYKKKPLLIKNKYKNKKTNKLELINFELKNKLVDIETNLNSNDLSELKLVSSKEYDPFNKNVNDYWLVNDDKCKEVSLLYDINPYDSNNITSLIYEMIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.17
4 0.17
5 0.19
6 0.17
7 0.15
8 0.13
9 0.12
10 0.13
11 0.12
12 0.1
13 0.1
14 0.09
15 0.1
16 0.12
17 0.1
18 0.09
19 0.1
20 0.1
21 0.1
22 0.17
23 0.22
24 0.25
25 0.29
26 0.33
27 0.34
28 0.38
29 0.39
30 0.36
31 0.41
32 0.41
33 0.45
34 0.48
35 0.55
36 0.58
37 0.64
38 0.7
39 0.68
40 0.68
41 0.64
42 0.61
43 0.6
44 0.6
45 0.6
46 0.6
47 0.59
48 0.61
49 0.66
50 0.68
51 0.65
52 0.6
53 0.51
54 0.46
55 0.47
56 0.42
57 0.36
58 0.32
59 0.31
60 0.32
61 0.33
62 0.31
63 0.23
64 0.24
65 0.24
66 0.23
67 0.2
68 0.18
69 0.18
70 0.19
71 0.25
72 0.28
73 0.31
74 0.37
75 0.43
76 0.5
77 0.58
78 0.62
79 0.58
80 0.57
81 0.55
82 0.52
83 0.5
84 0.45
85 0.45
86 0.46
87 0.5
88 0.5
89 0.48
90 0.45
91 0.4
92 0.37
93 0.27
94 0.22
95 0.16
96 0.14
97 0.13
98 0.14
99 0.15
100 0.14
101 0.13
102 0.12
103 0.15
104 0.14
105 0.15
106 0.13
107 0.13
108 0.13
109 0.14
110 0.16
111 0.13
112 0.16
113 0.14
114 0.14
115 0.14
116 0.14
117 0.13
118 0.11
119 0.11
120 0.09
121 0.1
122 0.1
123 0.1
124 0.1
125 0.11
126 0.11
127 0.11
128 0.14
129 0.2
130 0.26
131 0.33
132 0.4
133 0.47
134 0.57
135 0.67
136 0.7
137 0.72
138 0.74
139 0.74
140 0.72
141 0.7
142 0.67
143 0.65
144 0.6
145 0.56
146 0.47
147 0.45
148 0.42
149 0.4
150 0.43
151 0.38
152 0.4
153 0.37
154 0.38
155 0.33
156 0.29
157 0.26
158 0.16
159 0.12
160 0.07
161 0.07
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.08
168 0.08
169 0.08
170 0.09
171 0.11
172 0.12
173 0.14
174 0.15
175 0.18
176 0.21
177 0.22
178 0.21
179 0.23
180 0.3
181 0.28
182 0.28
183 0.25
184 0.25
185 0.26
186 0.28
187 0.27
188 0.22
189 0.2
190 0.21
191 0.23
192 0.22
193 0.24
194 0.25
195 0.24
196 0.22
197 0.22
198 0.25
199 0.3
200 0.31
201 0.33
202 0.33
203 0.34
204 0.39
205 0.38
206 0.4
207 0.33
208 0.3
209 0.23
210 0.23
211 0.22
212 0.17
213 0.2
214 0.16
215 0.15
216 0.18
217 0.18
218 0.17
219 0.26
220 0.26
221 0.28
222 0.34
223 0.37
224 0.36
225 0.36
226 0.36
227 0.29
228 0.3
229 0.27
230 0.22
231 0.23
232 0.2
233 0.2
234 0.2
235 0.2
236 0.18
237 0.18
238 0.16
239 0.15
240 0.17
241 0.18
242 0.18
243 0.18
244 0.23
245 0.31
246 0.35
247 0.38
248 0.37
249 0.42
250 0.47
251 0.54
252 0.6
253 0.6
254 0.67
255 0.72
256 0.81
257 0.84
258 0.88
259 0.88
260 0.88
261 0.88
262 0.85
263 0.86
264 0.85
265 0.83
266 0.79
267 0.74
268 0.72
269 0.68
270 0.61
271 0.52
272 0.44
273 0.36
274 0.32
275 0.27
276 0.2
277 0.13
278 0.14
279 0.18
280 0.23
281 0.23
282 0.25
283 0.24
284 0.23
285 0.22
286 0.21
287 0.17
288 0.11
289 0.11
290 0.1
291 0.1
292 0.1
293 0.14
294 0.14
295 0.15
296 0.18
297 0.18
298 0.21
299 0.28
300 0.33
301 0.34
302 0.38
303 0.42
304 0.42
305 0.42
306 0.41
307 0.4
308 0.39
309 0.35
310 0.35
311 0.33
312 0.32
313 0.32
314 0.35
315 0.32
316 0.31
317 0.31
318 0.29
319 0.24
320 0.22
321 0.24
322 0.24
323 0.24
324 0.22
325 0.27
326 0.26
327 0.28
328 0.28
329 0.26
330 0.24
331 0.22
332 0.23
333 0.18
334 0.19
335 0.17
336 0.16
337 0.16