Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T9L5

Protein Details
Accession A0A1B7T9L5   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
57-77AAAPKEDSKKPKKKLPSAKKDBasic
NLS Segment(s)
PositionSequence
61-77KEDSKKPKKKLPSAKKD
Subcellular Location(s) cyto 13, mito 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012098  SND3_fun  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0045047  P:protein targeting to ER  
Pfam View protein in Pfam  
PF10032  Pho88  
Amino Acid Sequences MYTSWMMMAGMHLYMKYTQPMVMQGISPIKSVFEHDLFKAYIMGQEVERPFGQQAAAAAPKEDSKKPKKKLPSAKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.11
6 0.12
7 0.14
8 0.15
9 0.14
10 0.13
11 0.14
12 0.17
13 0.16
14 0.16
15 0.14
16 0.12
17 0.12
18 0.14
19 0.15
20 0.13
21 0.14
22 0.14
23 0.16
24 0.16
25 0.16
26 0.14
27 0.11
28 0.1
29 0.09
30 0.1
31 0.07
32 0.11
33 0.11
34 0.14
35 0.13
36 0.13
37 0.12
38 0.12
39 0.12
40 0.09
41 0.09
42 0.11
43 0.13
44 0.12
45 0.13
46 0.13
47 0.17
48 0.2
49 0.25
50 0.31
51 0.39
52 0.5
53 0.57
54 0.66
55 0.73
56 0.8
57 0.85