Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7T9H9

Protein Details
Accession A0A1B7T9H9   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-83LTRWANNNKKKRIQKNNTDIDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto_nucl 10, mito 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029021  Prot-tyrosine_phosphatase-like  
IPR026893  Tyr/Ser_Pase_IphP-type  
Gene Ontology GO:0004721  F:phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF13350  Y_phosphatase3  
Amino Acid Sequences MNVIFKEIIEFTAIKKKLTLIGQENGVLFVSKKGHIKTSLISLILLKLLGVDDYTICMEHCLTRWANNNKKKRIQKNNTDIDYITTNDSLIMMKLIERIDTTFGSIEDYVTNVLEIDFEIIMKLREQYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.27
5 0.3
6 0.35
7 0.31
8 0.33
9 0.35
10 0.36
11 0.34
12 0.29
13 0.25
14 0.18
15 0.13
16 0.12
17 0.13
18 0.14
19 0.18
20 0.19
21 0.23
22 0.25
23 0.26
24 0.25
25 0.28
26 0.28
27 0.24
28 0.23
29 0.19
30 0.17
31 0.15
32 0.13
33 0.07
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.03
40 0.04
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.09
49 0.09
50 0.13
51 0.21
52 0.3
53 0.39
54 0.47
55 0.55
56 0.59
57 0.68
58 0.74
59 0.76
60 0.78
61 0.79
62 0.81
63 0.82
64 0.83
65 0.77
66 0.69
67 0.59
68 0.49
69 0.42
70 0.32
71 0.24
72 0.14
73 0.12
74 0.1
75 0.1
76 0.08
77 0.07
78 0.06
79 0.05
80 0.05
81 0.08
82 0.08
83 0.08
84 0.09
85 0.1
86 0.12
87 0.12
88 0.13
89 0.11
90 0.11
91 0.14
92 0.13
93 0.13
94 0.1
95 0.11
96 0.1
97 0.09
98 0.09
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.1