Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7TFP9

Protein Details
Accession A0A1B7TFP9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28TNERRYQCLKCSKSFKRHEHLKRHIITHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences VTNERRYQCLKCSKSFKRHEHLKRHIITHTGEKLFKCDYPFCNKKFSRSDEVKRHYKIHLTNTIENKIIKQNKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.8
4 0.79
5 0.84
6 0.85
7 0.86
8 0.85
9 0.84
10 0.78
11 0.72
12 0.64
13 0.57
14 0.49
15 0.45
16 0.42
17 0.35
18 0.33
19 0.3
20 0.31
21 0.29
22 0.28
23 0.24
24 0.21
25 0.22
26 0.29
27 0.35
28 0.34
29 0.42
30 0.41
31 0.46
32 0.49
33 0.52
34 0.51
35 0.54
36 0.62
37 0.63
38 0.7
39 0.71
40 0.68
41 0.65
42 0.59
43 0.57
44 0.54
45 0.52
46 0.53
47 0.52
48 0.55
49 0.58
50 0.58
51 0.54
52 0.49
53 0.44
54 0.44
55 0.47
56 0.49