Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8DBH6

Protein Details
Accession A0A1B8DBH6    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-125DERNGDKKGRRERANNDDGGBasic
NLS Segment(s)
PositionSequence
88-118TNRGKKGAATNGDKKGRADERNGDKKGRRER
Subcellular Location(s) cyto 12.5, cyto_nucl 12.5, nucl 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MALENGIPSVADPKVREEPTKSFKDAVVEGEEAGVNGQEEGEVDGHAEEGETVLPKSFAEVVVEGAKEGADEGGSTATNGEKKSAGETNRGKKGAATNGDKKGRADERNGDKKGRRERANNDDGGKSYAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.34
4 0.36
5 0.44
6 0.48
7 0.53
8 0.49
9 0.43
10 0.41
11 0.42
12 0.37
13 0.31
14 0.27
15 0.22
16 0.19
17 0.18
18 0.17
19 0.13
20 0.11
21 0.09
22 0.05
23 0.04
24 0.04
25 0.03
26 0.04
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.03
36 0.03
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.09
51 0.07
52 0.07
53 0.06
54 0.05
55 0.05
56 0.04
57 0.02
58 0.02
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.13
71 0.18
72 0.18
73 0.25
74 0.33
75 0.4
76 0.46
77 0.46
78 0.43
79 0.4
80 0.44
81 0.43
82 0.43
83 0.42
84 0.43
85 0.51
86 0.55
87 0.55
88 0.5
89 0.5
90 0.5
91 0.46
92 0.45
93 0.46
94 0.52
95 0.6
96 0.63
97 0.63
98 0.61
99 0.67
100 0.72
101 0.72
102 0.7
103 0.69
104 0.75
105 0.78
106 0.8
107 0.77
108 0.7
109 0.63
110 0.57
111 0.51