Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZE53

Protein Details
Accession C7ZE53    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
446-471AIYFGFRWEKKRAKKQGQLTTGRSKDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
KEGG nhe:NECHADRAFT_87447  -  
Pfam View protein in Pfam  
PF07690  MFS_1  
Amino Acid Sequences MTTDIIQAHEASSPSSYDPDSKTPVQAVLEDRGYVDPKEERAFVWRLDLGFLVIGFLGYMFKYIDQTNISNAYVSGMKEDLSLYGNELNFFTTYFNIGYIIMLWPSCIIISHIGPSKWLPACEVYGLRFLIGFFEGTTWPAYFTMISQWYLPHEVALRMSLYNIAQPAGAMISGAMQGGLSTNMEGVLGRSGWRWAFIINGVCTIAVALVAFFLLPGYPESPNRLAKFYLKPRHIEIALARARRVNRKPQIGITPKSFLRCFTFWQLWAIGIAWPIGGNFAPANYYNLWLKSLKNPDGTKKYTVAMLNYLPIIGQAAQLAAEVIYSSASDYFGTRLPFLLVHSTVNITSLAILIVRPQNEKLYMAGWYMNYTGAVSMMLLCSWASENLPHEPQVRTMLFASGTLFAYLLSAFVPLAAYPASEAPNWRIGAKLYMGFATFAVFLYFAIYFGFRWEKKRAKKQGQLTTGRSKDDAEPGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.19
5 0.24
6 0.28
7 0.33
8 0.34
9 0.36
10 0.35
11 0.37
12 0.33
13 0.33
14 0.31
15 0.3
16 0.29
17 0.26
18 0.26
19 0.25
20 0.26
21 0.22
22 0.23
23 0.2
24 0.23
25 0.26
26 0.26
27 0.24
28 0.28
29 0.31
30 0.27
31 0.29
32 0.27
33 0.24
34 0.25
35 0.24
36 0.19
37 0.16
38 0.15
39 0.1
40 0.07
41 0.07
42 0.05
43 0.05
44 0.05
45 0.04
46 0.06
47 0.06
48 0.06
49 0.09
50 0.1
51 0.13
52 0.16
53 0.17
54 0.2
55 0.22
56 0.22
57 0.2
58 0.2
59 0.18
60 0.17
61 0.16
62 0.14
63 0.12
64 0.12
65 0.12
66 0.12
67 0.11
68 0.11
69 0.11
70 0.11
71 0.14
72 0.14
73 0.15
74 0.15
75 0.15
76 0.13
77 0.13
78 0.12
79 0.09
80 0.11
81 0.1
82 0.1
83 0.1
84 0.1
85 0.09
86 0.09
87 0.09
88 0.08
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.06
95 0.06
96 0.08
97 0.09
98 0.13
99 0.18
100 0.17
101 0.19
102 0.19
103 0.25
104 0.24
105 0.24
106 0.21
107 0.19
108 0.2
109 0.22
110 0.23
111 0.18
112 0.19
113 0.19
114 0.17
115 0.15
116 0.14
117 0.12
118 0.11
119 0.1
120 0.06
121 0.08
122 0.08
123 0.09
124 0.1
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.08
131 0.12
132 0.13
133 0.13
134 0.13
135 0.13
136 0.15
137 0.17
138 0.17
139 0.13
140 0.12
141 0.12
142 0.12
143 0.13
144 0.12
145 0.1
146 0.1
147 0.1
148 0.09
149 0.1
150 0.1
151 0.09
152 0.08
153 0.07
154 0.07
155 0.06
156 0.05
157 0.04
158 0.03
159 0.03
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.07
179 0.07
180 0.08
181 0.08
182 0.07
183 0.08
184 0.1
185 0.13
186 0.12
187 0.13
188 0.12
189 0.11
190 0.11
191 0.1
192 0.07
193 0.04
194 0.03
195 0.02
196 0.02
197 0.02
198 0.02
199 0.02
200 0.02
201 0.02
202 0.03
203 0.04
204 0.05
205 0.07
206 0.08
207 0.12
208 0.16
209 0.2
210 0.21
211 0.22
212 0.22
213 0.25
214 0.32
215 0.38
216 0.43
217 0.41
218 0.42
219 0.43
220 0.46
221 0.41
222 0.35
223 0.26
224 0.27
225 0.29
226 0.27
227 0.25
228 0.24
229 0.26
230 0.33
231 0.37
232 0.38
233 0.41
234 0.47
235 0.48
236 0.49
237 0.56
238 0.54
239 0.53
240 0.46
241 0.43
242 0.37
243 0.39
244 0.35
245 0.27
246 0.26
247 0.24
248 0.24
249 0.25
250 0.26
251 0.23
252 0.25
253 0.23
254 0.18
255 0.17
256 0.15
257 0.1
258 0.08
259 0.07
260 0.05
261 0.05
262 0.05
263 0.05
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.06
270 0.08
271 0.08
272 0.1
273 0.11
274 0.12
275 0.14
276 0.14
277 0.15
278 0.2
279 0.27
280 0.29
281 0.34
282 0.36
283 0.42
284 0.49
285 0.51
286 0.47
287 0.41
288 0.38
289 0.36
290 0.35
291 0.28
292 0.23
293 0.2
294 0.18
295 0.16
296 0.15
297 0.11
298 0.09
299 0.09
300 0.06
301 0.06
302 0.05
303 0.05
304 0.05
305 0.05
306 0.05
307 0.04
308 0.03
309 0.03
310 0.03
311 0.03
312 0.03
313 0.04
314 0.04
315 0.05
316 0.05
317 0.06
318 0.07
319 0.1
320 0.11
321 0.11
322 0.11
323 0.11
324 0.12
325 0.12
326 0.15
327 0.13
328 0.13
329 0.13
330 0.14
331 0.13
332 0.13
333 0.12
334 0.08
335 0.07
336 0.07
337 0.06
338 0.05
339 0.05
340 0.08
341 0.11
342 0.13
343 0.14
344 0.16
345 0.18
346 0.2
347 0.21
348 0.18
349 0.16
350 0.15
351 0.15
352 0.15
353 0.13
354 0.13
355 0.12
356 0.12
357 0.11
358 0.09
359 0.08
360 0.07
361 0.06
362 0.05
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.06
370 0.07
371 0.07
372 0.09
373 0.12
374 0.17
375 0.19
376 0.21
377 0.23
378 0.24
379 0.25
380 0.3
381 0.28
382 0.25
383 0.24
384 0.23
385 0.2
386 0.2
387 0.19
388 0.14
389 0.14
390 0.12
391 0.11
392 0.09
393 0.09
394 0.09
395 0.07
396 0.05
397 0.05
398 0.05
399 0.05
400 0.05
401 0.05
402 0.06
403 0.06
404 0.06
405 0.07
406 0.09
407 0.11
408 0.11
409 0.14
410 0.16
411 0.23
412 0.24
413 0.23
414 0.22
415 0.21
416 0.24
417 0.25
418 0.24
419 0.19
420 0.19
421 0.19
422 0.18
423 0.17
424 0.15
425 0.12
426 0.1
427 0.09
428 0.08
429 0.07
430 0.09
431 0.09
432 0.08
433 0.08
434 0.09
435 0.08
436 0.13
437 0.22
438 0.22
439 0.28
440 0.37
441 0.46
442 0.56
443 0.68
444 0.74
445 0.77
446 0.83
447 0.88
448 0.89
449 0.9
450 0.88
451 0.85
452 0.84
453 0.77
454 0.71
455 0.62
456 0.54
457 0.48
458 0.48