FuNGI

C7ZE53

Protein Details

Accession

C7ZE53

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
446-471	AIYFGFRWEKKRAKKQGQLTTGRSKD	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 26

Family & Domain DBs

InterPro	View protein in InterPro IPR011701 MFS IPR036259 MFS_trans_sf
Gene Ontology	GO:0016020 C:membrane GO:0022857 F:transmembrane transporter activity
KEGG	nhe:NECHADRAFT_87447 -
Pfam	View protein in Pfam PF07690 MFS_1

Amino Acid Sequences

MTTDIIQAHEASSPSSYDPDSKTPVQAVLEDRGYVDPKEERAFVWRLDLGFLVIGFLGYMFKYIDQTNISNAYVSGMKEDLSLYGNELNFFTTYFNIGYIIMLWPSCIIISHIGPSKWLPACEVYGLRFLIGFFEGTTWPAYFTMISQWYLPHEVALRMSLYNIAQPAGAMISGAMQGGLSTNMEGVLGRSGWRWAFIINGVCTIAVALVAFFLLPGYPESPNRLAKFYLKPRHIEIALARARRVNRKPQIGITPKSFLRCFTFWQLWAIGIAWPIGGNFAPANYYNLWLKSLKNPDGTKKYTVAMLNYLPIIGQAAQLAAEVIYSSASDYFGTRLPFLLVHSTVNITSLAILIVRPQNEKLYMAGWYMNYTGAVSMMLLCSWASENLPHEPQVRTMLFASGTLFAYLLSAFVPLAAYPASEAPNWRIGAKLYMGFATFAVFLYFAIYFGFRWEKKRAKKQGQLTTGRSKDDAEPGSE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.16
3	0.17
4	0.19
5	0.24
6	0.28
7	0.33
8	0.34
9	0.36
10	0.35
11	0.37
12	0.33
13	0.33
14	0.31
15	0.3
16	0.29
17	0.26
18	0.26
19	0.25
20	0.26
21	0.22
22	0.23
23	0.2
24	0.23
25	0.26
26	0.26
27	0.24
28	0.28
29	0.31
30	0.27
31	0.29
32	0.27
33	0.24
34	0.25
35	0.24
36	0.19
37	0.16
38	0.15
39	0.1
40	0.07
41	0.07
42	0.05
43	0.05
44	0.05
45	0.04
46	0.06
47	0.06
48	0.06
49	0.09
50	0.1
51	0.13
52	0.16
53	0.17
54	0.2
55	0.22
56	0.22
57	0.2
58	0.2
59	0.18
60	0.17
61	0.16
62	0.14
63	0.12
64	0.12
65	0.12
66	0.12
67	0.11
68	0.11
69	0.11
70	0.11
71	0.14
72	0.14
73	0.15
74	0.15
75	0.15
76	0.13
77	0.13
78	0.12
79	0.09
80	0.11
81	0.1
82	0.1
83	0.1
84	0.1
85	0.09
86	0.09
87	0.09
88	0.08
89	0.07
90	0.07
91	0.07
92	0.07
93	0.06
94	0.06
95	0.06
96	0.08
97	0.09
98	0.13
99	0.18
100	0.17
101	0.19
102	0.19
103	0.25
104	0.24
105	0.24
106	0.21
107	0.19
108	0.2
109	0.22
110	0.23
111	0.18
112	0.19
113	0.19
114	0.17
115	0.15
116	0.14
117	0.12
118	0.11
119	0.1
120	0.06
121	0.08
122	0.08
123	0.09
124	0.1
125	0.09
126	0.09
127	0.09
128	0.09
129	0.08
130	0.08
131	0.12
132	0.13
133	0.13
134	0.13
135	0.13
136	0.15
137	0.17
138	0.17
139	0.13
140	0.12
141	0.12
142	0.12
143	0.13
144	0.12
145	0.1
146	0.1
147	0.1
148	0.09
149	0.1
150	0.1
151	0.09
152	0.08
153	0.07
154	0.07
155	0.06
156	0.05
157	0.04
158	0.03
159	0.03
160	0.04
161	0.04
162	0.03
163	0.03
164	0.03
165	0.04
166	0.04
167	0.04
168	0.04
169	0.04
170	0.04
171	0.04
172	0.04
173	0.04
174	0.05
175	0.05
176	0.05
177	0.06
178	0.07
179	0.07
180	0.08
181	0.08
182	0.07
183	0.08
184	0.1
185	0.13
186	0.12
187	0.13
188	0.12
189	0.11
190	0.11
191	0.1
192	0.07
193	0.04
194	0.03
195	0.02
196	0.02
197	0.02
198	0.02
199	0.02
200	0.02
201	0.02
202	0.03
203	0.04
204	0.05
205	0.07
206	0.08
207	0.12
208	0.16
209	0.2
210	0.21
211	0.22
212	0.22
213	0.25
214	0.32
215	0.38
216	0.43
217	0.41
218	0.42
219	0.43
220	0.46
221	0.41
222	0.35
223	0.26
224	0.27
225	0.29
226	0.27
227	0.25
228	0.24
229	0.26
230	0.33
231	0.37
232	0.38
233	0.41
234	0.47
235	0.48
236	0.49
237	0.56
238	0.54
239	0.53
240	0.46
241	0.43
242	0.37
243	0.39
244	0.35
245	0.27
246	0.26
247	0.24
248	0.24
249	0.25
250	0.26
251	0.23
252	0.25
253	0.23
254	0.18
255	0.17
256	0.15
257	0.1
258	0.08
259	0.07
260	0.05
261	0.05
262	0.05
263	0.05
264	0.04
265	0.04
266	0.04
267	0.04
268	0.05
269	0.06
270	0.08
271	0.08
272	0.1
273	0.11
274	0.12
275	0.14
276	0.14
277	0.15
278	0.2
279	0.27
280	0.29
281	0.34
282	0.36
283	0.42
284	0.49
285	0.51
286	0.47
287	0.41
288	0.38
289	0.36
290	0.35
291	0.28
292	0.23
293	0.2
294	0.18
295	0.16
296	0.15
297	0.11
298	0.09
299	0.09
300	0.06
301	0.06
302	0.05
303	0.05
304	0.05
305	0.05
306	0.05
307	0.04
308	0.03
309	0.03
310	0.03
311	0.03
312	0.03
313	0.04
314	0.04
315	0.05
316	0.05
317	0.06
318	0.07
319	0.1
320	0.11
321	0.11
322	0.11
323	0.11
324	0.12
325	0.12
326	0.15
327	0.13
328	0.13
329	0.13
330	0.14
331	0.13
332	0.13
333	0.12
334	0.08
335	0.07
336	0.07
337	0.06
338	0.05
339	0.05
340	0.08
341	0.11
342	0.13
343	0.14
344	0.16
345	0.18
346	0.2
347	0.21
348	0.18
349	0.16
350	0.15
351	0.15
352	0.15
353	0.13
354	0.13
355	0.12
356	0.12
357	0.11
358	0.09
359	0.08
360	0.07
361	0.06
362	0.05
363	0.05
364	0.05
365	0.05
366	0.05
367	0.05
368	0.05
369	0.06
370	0.07
371	0.07
372	0.09
373	0.12
374	0.17
375	0.19
376	0.21
377	0.23
378	0.24
379	0.25
380	0.3
381	0.28
382	0.25
383	0.24
384	0.23
385	0.2
386	0.2
387	0.19
388	0.14
389	0.14
390	0.12
391	0.11
392	0.09
393	0.09
394	0.09
395	0.07
396	0.05
397	0.05
398	0.05
399	0.05
400	0.05
401	0.05
402	0.06
403	0.06
404	0.06
405	0.07
406	0.09
407	0.11
408	0.11
409	0.14
410	0.16
411	0.23
412	0.24
413	0.23
414	0.22
415	0.21
416	0.24
417	0.25
418	0.24
419	0.19
420	0.19
421	0.19
422	0.18
423	0.17
424	0.15
425	0.12
426	0.1
427	0.09
428	0.08
429	0.07
430	0.09
431	0.09
432	0.08
433	0.08
434	0.09
435	0.08
436	0.13
437	0.22
438	0.22
439	0.28
440	0.37
441	0.46
442	0.56
443	0.68
444	0.74
445	0.77
446	0.83
447	0.88
448	0.89
449	0.9
450	0.88
451	0.85
452	0.84
453	0.77
454	0.71
455	0.62
456	0.54
457	0.48
458	0.48

C7ZE53

3D AlphaFold-predicted Structure Viewer