Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CYJ3

Protein Details
Accession A0A1B8CYJ3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MADRKAGKKSDKKADKKANKIEFSPHydrophilic
NLS Segment(s)
PositionSequence
4-18RKAGKKSDKKADKKA
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
Amino Acid Sequences MADRKAGKKSDKKADKKANKIEFSPAMPIPPVFDIEARIKTLQGYLDPSNPNYQPERQHVNIRAVIKLYEEGKIDGLHRTTVMGRLHLMRRPSLPSLGPGQRYYSYYES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.89
5 0.87
6 0.8
7 0.73
8 0.69
9 0.61
10 0.53
11 0.47
12 0.37
13 0.29
14 0.25
15 0.23
16 0.18
17 0.16
18 0.15
19 0.11
20 0.11
21 0.13
22 0.16
23 0.17
24 0.18
25 0.17
26 0.16
27 0.15
28 0.16
29 0.13
30 0.11
31 0.14
32 0.13
33 0.18
34 0.18
35 0.19
36 0.22
37 0.21
38 0.23
39 0.21
40 0.23
41 0.22
42 0.26
43 0.3
44 0.29
45 0.35
46 0.36
47 0.37
48 0.38
49 0.35
50 0.32
51 0.26
52 0.24
53 0.19
54 0.18
55 0.14
56 0.13
57 0.12
58 0.12
59 0.12
60 0.13
61 0.13
62 0.14
63 0.14
64 0.12
65 0.12
66 0.12
67 0.12
68 0.17
69 0.17
70 0.16
71 0.17
72 0.21
73 0.25
74 0.27
75 0.29
76 0.26
77 0.28
78 0.32
79 0.33
80 0.32
81 0.29
82 0.29
83 0.35
84 0.38
85 0.39
86 0.36
87 0.37
88 0.36
89 0.37