Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CYL8

Protein Details
Accession A0A1B8CYL8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-81PPGLRTPPPKPPRPNPRLNTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MGRRPGRAAAKQAAVALKNTPQTIEDPEDETMADVPTSDPVSPRDDDDDDDPDADDDGTPAPPGLRTPPPKPPRPNPRLNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.25
4 0.23
5 0.23
6 0.22
7 0.2
8 0.17
9 0.18
10 0.21
11 0.23
12 0.2
13 0.2
14 0.2
15 0.2
16 0.18
17 0.17
18 0.13
19 0.09
20 0.08
21 0.05
22 0.05
23 0.06
24 0.07
25 0.07
26 0.07
27 0.08
28 0.12
29 0.12
30 0.13
31 0.15
32 0.15
33 0.16
34 0.18
35 0.19
36 0.16
37 0.16
38 0.15
39 0.12
40 0.11
41 0.1
42 0.08
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.08
51 0.13
52 0.21
53 0.27
54 0.32
55 0.43
56 0.51
57 0.61
58 0.69
59 0.74
60 0.77
61 0.8