Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZPA2

Protein Details
Accession C7ZPA2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
25-47LELARPKQQKHPEPIQRRQDHDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 10
Family & Domain DBs
KEGG nhe:NECHADRAFT_85648  -  
Amino Acid Sequences MALASMAGSQLAWTVHSSMGALDLLELARPKQQKHPEPIQRRQDHDEEIGYITLQVLYPDEEFENPQDEDKRLLPTATYHENDPSRVFLPEPLRTMTHLRPSGIASLRLAPRVLITSQEPERLSPSTSWSETELVLLFVPIDPSPGSSSVSEVSCAMFPTVWPLSEGLRDRARGTDGMILRFIGPIRRRDASGALSIYDALGVFVSFAAPVAECLGWRLRRSGQEVSPFATGRHFEASNVYRERFEALAMAPFSLRDHDHKEAHGGTSTPRKENEYPDPRGIHISDLEPRFPTVDRRVPRAPKPPPFPLLSCGLDDRSTKYRTKLTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.09
6 0.11
7 0.1
8 0.09
9 0.07
10 0.07
11 0.07
12 0.09
13 0.09
14 0.09
15 0.15
16 0.19
17 0.22
18 0.31
19 0.42
20 0.49
21 0.57
22 0.67
23 0.72
24 0.78
25 0.85
26 0.87
27 0.83
28 0.8
29 0.78
30 0.72
31 0.65
32 0.58
33 0.5
34 0.41
35 0.35
36 0.29
37 0.23
38 0.18
39 0.13
40 0.11
41 0.09
42 0.07
43 0.06
44 0.08
45 0.08
46 0.1
47 0.1
48 0.11
49 0.12
50 0.13
51 0.17
52 0.15
53 0.18
54 0.19
55 0.19
56 0.22
57 0.22
58 0.25
59 0.22
60 0.21
61 0.19
62 0.19
63 0.23
64 0.27
65 0.26
66 0.23
67 0.28
68 0.3
69 0.31
70 0.29
71 0.27
72 0.21
73 0.21
74 0.2
75 0.2
76 0.24
77 0.26
78 0.27
79 0.27
80 0.26
81 0.28
82 0.33
83 0.31
84 0.34
85 0.32
86 0.3
87 0.29
88 0.3
89 0.33
90 0.3
91 0.27
92 0.2
93 0.23
94 0.24
95 0.24
96 0.22
97 0.16
98 0.15
99 0.16
100 0.15
101 0.11
102 0.12
103 0.16
104 0.17
105 0.21
106 0.21
107 0.19
108 0.22
109 0.21
110 0.21
111 0.16
112 0.19
113 0.19
114 0.19
115 0.2
116 0.19
117 0.19
118 0.17
119 0.17
120 0.13
121 0.1
122 0.09
123 0.08
124 0.06
125 0.05
126 0.06
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.08
133 0.09
134 0.09
135 0.1
136 0.11
137 0.11
138 0.1
139 0.09
140 0.09
141 0.08
142 0.08
143 0.07
144 0.05
145 0.05
146 0.09
147 0.09
148 0.09
149 0.09
150 0.09
151 0.1
152 0.14
153 0.15
154 0.14
155 0.16
156 0.17
157 0.17
158 0.18
159 0.18
160 0.15
161 0.15
162 0.17
163 0.16
164 0.16
165 0.16
166 0.15
167 0.14
168 0.14
169 0.13
170 0.13
171 0.15
172 0.18
173 0.21
174 0.22
175 0.23
176 0.24
177 0.26
178 0.23
179 0.23
180 0.2
181 0.16
182 0.15
183 0.15
184 0.13
185 0.1
186 0.07
187 0.04
188 0.04
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.05
199 0.05
200 0.05
201 0.07
202 0.12
203 0.15
204 0.16
205 0.19
206 0.21
207 0.26
208 0.31
209 0.35
210 0.34
211 0.4
212 0.4
213 0.4
214 0.39
215 0.34
216 0.3
217 0.27
218 0.23
219 0.17
220 0.19
221 0.17
222 0.14
223 0.21
224 0.23
225 0.28
226 0.31
227 0.3
228 0.26
229 0.27
230 0.29
231 0.22
232 0.2
233 0.14
234 0.11
235 0.15
236 0.15
237 0.15
238 0.12
239 0.12
240 0.12
241 0.13
242 0.14
243 0.14
244 0.21
245 0.26
246 0.28
247 0.29
248 0.33
249 0.32
250 0.32
251 0.29
252 0.23
253 0.22
254 0.29
255 0.32
256 0.31
257 0.32
258 0.37
259 0.39
260 0.45
261 0.52
262 0.51
263 0.54
264 0.57
265 0.57
266 0.51
267 0.52
268 0.45
269 0.37
270 0.3
271 0.27
272 0.29
273 0.29
274 0.3
275 0.26
276 0.27
277 0.26
278 0.25
279 0.29
280 0.3
281 0.37
282 0.39
283 0.45
284 0.54
285 0.6
286 0.67
287 0.71
288 0.72
289 0.73
290 0.77
291 0.77
292 0.73
293 0.71
294 0.65
295 0.58
296 0.55
297 0.47
298 0.42
299 0.37
300 0.34
301 0.32
302 0.31
303 0.33
304 0.33
305 0.36
306 0.37
307 0.4