Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D946

Protein Details
Accession A0A1B8D946    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-37LPVMGYQKYRKHKARKALKKELDAQPHydrophilic
NLS Segment(s)
PositionSequence
21-31RKHKARKALKK
Subcellular Location(s) extr 22, mito 4
Family & Domain DBs
Amino Acid Sequences MAAVVLMAIVVLPVMGYQKYRKHKARKALKKELDAQPEPLQGGHQAAWEQSGDHPPSYDDTVGSHPSPPYSSNKPPGYVQRTSGNRGLPVGHLPGSYLSPTAVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.08
4 0.13
5 0.22
6 0.31
7 0.41
8 0.5
9 0.6
10 0.67
11 0.75
12 0.81
13 0.84
14 0.85
15 0.87
16 0.85
17 0.8
18 0.8
19 0.77
20 0.74
21 0.64
22 0.58
23 0.5
24 0.44
25 0.38
26 0.3
27 0.23
28 0.15
29 0.15
30 0.11
31 0.08
32 0.08
33 0.07
34 0.08
35 0.07
36 0.07
37 0.07
38 0.11
39 0.11
40 0.11
41 0.11
42 0.11
43 0.13
44 0.14
45 0.13
46 0.09
47 0.09
48 0.12
49 0.14
50 0.15
51 0.14
52 0.13
53 0.14
54 0.15
55 0.15
56 0.19
57 0.24
58 0.3
59 0.37
60 0.39
61 0.41
62 0.43
63 0.5
64 0.51
65 0.46
66 0.43
67 0.43
68 0.45
69 0.48
70 0.49
71 0.42
72 0.36
73 0.34
74 0.32
75 0.25
76 0.24
77 0.22
78 0.19
79 0.17
80 0.16
81 0.17
82 0.18
83 0.17
84 0.14
85 0.11