Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DF98

Protein Details
Accession A0A1B8DF98   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
200-219LFLRDLELRRRERRERLKEABasic
NLS Segment(s)
PositionSequence
209-215RRERRER
Subcellular Location(s) plas 17, mito 5, E.R. 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0102756  F:very-long-chain 3-ketoacyl-CoA synthase activity  
Amino Acid Sequences MIERLFAAIAAAPPMTLMISQSALFITLWLALRRHVSLNGPIPGARTLTTINSWFYALVSLGLFLIILSPFHDFLARSLYHASKFYEYVDILNVLASGGEIDLHFGVHHLTTMYMTYARVLHHSEGWRVFAALNTAHHVVMYAFFGGATWVHPILPWTGTLQLLVGIVADFWVGRKKIERGEEVWPNFVGGGLLATYFLLFLRDLELRRRERRERLKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.06
4 0.06
5 0.07
6 0.08
7 0.09
8 0.09
9 0.09
10 0.1
11 0.09
12 0.09
13 0.07
14 0.09
15 0.11
16 0.13
17 0.14
18 0.15
19 0.18
20 0.19
21 0.21
22 0.2
23 0.21
24 0.26
25 0.32
26 0.32
27 0.3
28 0.29
29 0.28
30 0.27
31 0.25
32 0.19
33 0.14
34 0.13
35 0.14
36 0.17
37 0.16
38 0.16
39 0.16
40 0.16
41 0.14
42 0.13
43 0.11
44 0.09
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.05
53 0.04
54 0.04
55 0.04
56 0.06
57 0.06
58 0.07
59 0.08
60 0.07
61 0.08
62 0.13
63 0.13
64 0.13
65 0.15
66 0.16
67 0.17
68 0.18
69 0.2
70 0.16
71 0.16
72 0.16
73 0.16
74 0.15
75 0.14
76 0.13
77 0.11
78 0.09
79 0.09
80 0.08
81 0.05
82 0.04
83 0.04
84 0.03
85 0.02
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.09
107 0.1
108 0.11
109 0.14
110 0.16
111 0.18
112 0.17
113 0.18
114 0.17
115 0.15
116 0.14
117 0.11
118 0.11
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.1
125 0.1
126 0.09
127 0.08
128 0.08
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.08
142 0.09
143 0.09
144 0.09
145 0.1
146 0.1
147 0.1
148 0.09
149 0.08
150 0.08
151 0.07
152 0.06
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.04
159 0.1
160 0.1
161 0.12
162 0.16
163 0.2
164 0.27
165 0.33
166 0.36
167 0.34
168 0.42
169 0.5
170 0.47
171 0.46
172 0.4
173 0.34
174 0.29
175 0.26
176 0.18
177 0.09
178 0.07
179 0.05
180 0.05
181 0.05
182 0.05
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.06
189 0.09
190 0.13
191 0.15
192 0.23
193 0.32
194 0.39
195 0.48
196 0.57
197 0.62
198 0.7
199 0.79