Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CSD9

Protein Details
Accession A0A1B8CSD9   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MSTTTSMRKRVRKACIPCHQRKRKCDAEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MSTTTSMRKRVRKACIPCHQRKRKCDAEYPCGMCATYEYNCRYADDTTGTTTRRRACCAPMMGPDVDDTTDTPGGDVHSSPPRDLRGLRPAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.85
4 0.86
5 0.88
6 0.9
7 0.88
8 0.87
9 0.85
10 0.84
11 0.79
12 0.78
13 0.74
14 0.71
15 0.7
16 0.65
17 0.58
18 0.48
19 0.42
20 0.32
21 0.25
22 0.21
23 0.15
24 0.17
25 0.18
26 0.2
27 0.2
28 0.21
29 0.21
30 0.18
31 0.18
32 0.15
33 0.14
34 0.14
35 0.16
36 0.16
37 0.16
38 0.19
39 0.25
40 0.24
41 0.27
42 0.27
43 0.29
44 0.34
45 0.36
46 0.35
47 0.32
48 0.34
49 0.3
50 0.28
51 0.25
52 0.19
53 0.16
54 0.14
55 0.1
56 0.11
57 0.12
58 0.12
59 0.11
60 0.11
61 0.12
62 0.12
63 0.12
64 0.13
65 0.19
66 0.21
67 0.22
68 0.26
69 0.27
70 0.3
71 0.33
72 0.35
73 0.38