Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YJY8

Protein Details
Accession C7YJY8   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-85DAPAPAAKVTKKRKTKKEEDSTPLADHydrophilic
415-445QVDRKAVKDSKKGTRGKKGAKKKKDETDDSEBasic
NLS Segment(s)
PositionSequence
36-76AIGKAKGAVAKTVTKRKAEPEPEIDAPAPAAKVTKKRKTKK
418-438RKAVKDSKKGTRGKKGAKKKK
Subcellular Location(s) nucl 11cyto 11cyto_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR001719  AP_endonuc_2  
IPR018246  AP_endonuc_F2_Zn_BS  
IPR036237  Xyl_isomerase-like_sf  
IPR013022  Xyl_isomerase-like_TIM-brl  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0017005  F:3'-tyrosyl-DNA phosphodiesterase activity  
GO:0003677  F:DNA binding  
GO:0003906  F:DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0008311  F:double-stranded DNA 3'-5' DNA exonuclease activity  
GO:0008270  F:zinc ion binding  
GO:0006284  P:base-excision repair  
KEGG nhe:NECHADRAFT_74423  -  
Pfam View protein in Pfam  
PF01261  AP_endonuc_2  
PROSITE View protein in PROSITE  
PS00730  AP_NUCLEASE_F2_2  
PS51432  AP_NUCLEASE_F2_4  
CDD cd00019  AP2Ec  
Amino Acid Sequences MARTSLRKRQAVSYNEDDNDDEMPKVTKTVAAAGKAIGKAKGAVAKTVTKRKAEPEPEIDAPAPAAKVTKKRKTKKEEDSTPLADRTAISSLKPAMHIGAHVSAAGGVQNSVTNAIHIGANAFALFLKSQRKWTNPPLDPSAKTQFISQCKHHGYSAAEHALPHGSYLVNLAQADEEKANQAYTSFLDDLNRCEQLGIRLYNFHPGSTGGDSRAAAIGRIAAQLNKSHKATKTVITVLENMAGSGNVIGSTWEDLRDIIALVEDKERVGVCIDTCHAFAAGHDLRTPEAFKKTVDSFNEIVGHKYLKAFHLNDSKAPFDSNRDLHANIGTGFLGLRAFHSIMNHAPFAGMPMVLETPIDRPGSDGKSVEDKKVWADEIKLLESLVGMDAESEEFKQLEEELQARGEAERNKIQDQVDRKAVKDSKKGTRGKKGAKKKKDETDDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.56
4 0.48
5 0.4
6 0.36
7 0.29
8 0.22
9 0.16
10 0.16
11 0.15
12 0.15
13 0.14
14 0.14
15 0.14
16 0.21
17 0.24
18 0.24
19 0.25
20 0.25
21 0.3
22 0.3
23 0.31
24 0.24
25 0.2
26 0.19
27 0.22
28 0.26
29 0.22
30 0.23
31 0.24
32 0.32
33 0.39
34 0.48
35 0.51
36 0.49
37 0.52
38 0.55
39 0.62
40 0.6
41 0.6
42 0.56
43 0.57
44 0.55
45 0.55
46 0.49
47 0.38
48 0.32
49 0.26
50 0.2
51 0.13
52 0.15
53 0.16
54 0.25
55 0.36
56 0.45
57 0.54
58 0.64
59 0.74
60 0.82
61 0.88
62 0.89
63 0.9
64 0.9
65 0.86
66 0.84
67 0.78
68 0.71
69 0.61
70 0.5
71 0.4
72 0.3
73 0.26
74 0.22
75 0.18
76 0.14
77 0.17
78 0.19
79 0.2
80 0.2
81 0.18
82 0.15
83 0.15
84 0.15
85 0.14
86 0.13
87 0.12
88 0.11
89 0.1
90 0.09
91 0.08
92 0.08
93 0.06
94 0.05
95 0.05
96 0.05
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.06
107 0.06
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.08
114 0.15
115 0.16
116 0.24
117 0.3
118 0.36
119 0.42
120 0.51
121 0.59
122 0.57
123 0.61
124 0.6
125 0.6
126 0.57
127 0.55
128 0.52
129 0.43
130 0.39
131 0.37
132 0.36
133 0.38
134 0.41
135 0.37
136 0.4
137 0.41
138 0.42
139 0.39
140 0.36
141 0.31
142 0.3
143 0.33
144 0.28
145 0.24
146 0.22
147 0.23
148 0.2
149 0.18
150 0.14
151 0.09
152 0.06
153 0.06
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.07
160 0.08
161 0.09
162 0.08
163 0.07
164 0.07
165 0.08
166 0.08
167 0.07
168 0.07
169 0.07
170 0.07
171 0.1
172 0.09
173 0.1
174 0.12
175 0.13
176 0.16
177 0.17
178 0.17
179 0.14
180 0.13
181 0.13
182 0.14
183 0.18
184 0.16
185 0.14
186 0.16
187 0.17
188 0.24
189 0.24
190 0.2
191 0.16
192 0.16
193 0.18
194 0.17
195 0.18
196 0.11
197 0.12
198 0.12
199 0.12
200 0.13
201 0.1
202 0.08
203 0.07
204 0.07
205 0.06
206 0.07
207 0.07
208 0.06
209 0.07
210 0.11
211 0.14
212 0.17
213 0.18
214 0.21
215 0.22
216 0.27
217 0.28
218 0.28
219 0.28
220 0.27
221 0.27
222 0.25
223 0.25
224 0.19
225 0.19
226 0.15
227 0.11
228 0.09
229 0.07
230 0.06
231 0.05
232 0.05
233 0.03
234 0.03
235 0.03
236 0.03
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.05
246 0.05
247 0.05
248 0.06
249 0.07
250 0.07
251 0.07
252 0.08
253 0.08
254 0.07
255 0.08
256 0.08
257 0.07
258 0.08
259 0.1
260 0.1
261 0.1
262 0.1
263 0.09
264 0.08
265 0.08
266 0.15
267 0.15
268 0.14
269 0.15
270 0.15
271 0.15
272 0.16
273 0.19
274 0.14
275 0.16
276 0.17
277 0.16
278 0.2
279 0.23
280 0.28
281 0.28
282 0.31
283 0.28
284 0.29
285 0.34
286 0.29
287 0.27
288 0.23
289 0.21
290 0.17
291 0.18
292 0.17
293 0.15
294 0.21
295 0.21
296 0.26
297 0.34
298 0.34
299 0.37
300 0.38
301 0.37
302 0.31
303 0.31
304 0.25
305 0.22
306 0.28
307 0.25
308 0.27
309 0.28
310 0.28
311 0.27
312 0.28
313 0.23
314 0.17
315 0.16
316 0.12
317 0.09
318 0.09
319 0.08
320 0.07
321 0.06
322 0.07
323 0.08
324 0.09
325 0.1
326 0.11
327 0.13
328 0.16
329 0.19
330 0.18
331 0.15
332 0.15
333 0.14
334 0.15
335 0.13
336 0.09
337 0.06
338 0.08
339 0.08
340 0.08
341 0.08
342 0.07
343 0.08
344 0.12
345 0.12
346 0.11
347 0.13
348 0.18
349 0.22
350 0.24
351 0.23
352 0.22
353 0.32
354 0.34
355 0.35
356 0.32
357 0.3
358 0.3
359 0.33
360 0.32
361 0.24
362 0.24
363 0.26
364 0.27
365 0.28
366 0.25
367 0.21
368 0.19
369 0.17
370 0.15
371 0.1
372 0.07
373 0.05
374 0.05
375 0.06
376 0.07
377 0.08
378 0.08
379 0.08
380 0.08
381 0.09
382 0.09
383 0.09
384 0.1
385 0.13
386 0.14
387 0.14
388 0.14
389 0.15
390 0.14
391 0.15
392 0.19
393 0.2
394 0.25
395 0.3
396 0.33
397 0.35
398 0.39
399 0.4
400 0.41
401 0.44
402 0.46
403 0.49
404 0.47
405 0.47
406 0.52
407 0.56
408 0.57
409 0.6
410 0.61
411 0.62
412 0.69
413 0.77
414 0.77
415 0.82
416 0.84
417 0.85
418 0.87
419 0.88
420 0.89
421 0.91
422 0.92
423 0.91
424 0.92
425 0.91