Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CV91

Protein Details
Accession A0A1B8CV91    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-128VYMVQRRKANYNKKRRAKRGTNGARLEHydrophilic
NLS Segment(s)
PositionSequence
108-121RKANYNKKRRAKRG
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013952  DUF1776_fun  
Pfam View protein in Pfam  
PF08643  DUF1776  
Amino Acid Sequences MSADDQAFLDALNSVPRHVQRYSNDIANYVEDHVDRVARTLRDTLASADWIPESARPKPVARAPAPPPVTALPGGVFARVQAWVLKNKVFTTAIVAGVGASVYMVQRRKANYNKKRRAKRGTNGARLEVVVISGSMNEPLVRPPALDLERRGFIVFIVCDDVQEELRVQSEGRSDIRPLVINVSTSKLGHDGVERFAQFLQTPQHAFDTARAHYLQFTALIVIPTLTYPNSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.18
3 0.21
4 0.25
5 0.26
6 0.33
7 0.32
8 0.38
9 0.42
10 0.43
11 0.41
12 0.38
13 0.37
14 0.31
15 0.28
16 0.23
17 0.2
18 0.14
19 0.15
20 0.14
21 0.15
22 0.13
23 0.14
24 0.18
25 0.17
26 0.2
27 0.21
28 0.21
29 0.21
30 0.22
31 0.22
32 0.18
33 0.19
34 0.17
35 0.15
36 0.14
37 0.12
38 0.12
39 0.13
40 0.16
41 0.17
42 0.22
43 0.24
44 0.25
45 0.3
46 0.35
47 0.4
48 0.39
49 0.44
50 0.43
51 0.49
52 0.5
53 0.44
54 0.41
55 0.34
56 0.33
57 0.26
58 0.22
59 0.13
60 0.14
61 0.14
62 0.12
63 0.1
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.1
70 0.14
71 0.17
72 0.18
73 0.19
74 0.19
75 0.22
76 0.2
77 0.17
78 0.18
79 0.18
80 0.16
81 0.15
82 0.14
83 0.11
84 0.1
85 0.1
86 0.04
87 0.02
88 0.02
89 0.03
90 0.06
91 0.08
92 0.09
93 0.12
94 0.15
95 0.22
96 0.31
97 0.42
98 0.49
99 0.59
100 0.68
101 0.75
102 0.83
103 0.85
104 0.86
105 0.85
106 0.82
107 0.82
108 0.82
109 0.81
110 0.73
111 0.65
112 0.55
113 0.45
114 0.38
115 0.27
116 0.17
117 0.07
118 0.06
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.07
128 0.07
129 0.07
130 0.08
131 0.13
132 0.16
133 0.18
134 0.19
135 0.21
136 0.21
137 0.22
138 0.22
139 0.16
140 0.14
141 0.14
142 0.11
143 0.09
144 0.12
145 0.11
146 0.11
147 0.11
148 0.12
149 0.1
150 0.1
151 0.1
152 0.07
153 0.08
154 0.08
155 0.08
156 0.09
157 0.11
158 0.13
159 0.15
160 0.16
161 0.17
162 0.18
163 0.2
164 0.2
165 0.19
166 0.2
167 0.19
168 0.18
169 0.19
170 0.2
171 0.19
172 0.18
173 0.18
174 0.15
175 0.15
176 0.14
177 0.18
178 0.16
179 0.18
180 0.22
181 0.22
182 0.21
183 0.21
184 0.21
185 0.17
186 0.19
187 0.21
188 0.21
189 0.22
190 0.23
191 0.25
192 0.24
193 0.25
194 0.26
195 0.27
196 0.24
197 0.27
198 0.26
199 0.24
200 0.24
201 0.24
202 0.19
203 0.14
204 0.13
205 0.11
206 0.12
207 0.12
208 0.11
209 0.1
210 0.1
211 0.09
212 0.11