Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZF14

Protein Details
Accession C7ZF14    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
486-510VRNPSFKAPFKTKRRTPEDDRNAQVHydrophilic
NLS Segment(s)
PositionSequence
585-589IRRRK
Subcellular Location(s) cyto 6, plas 5, extr 5, cyto_mito 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001128  Cyt_P450  
IPR002403  Cyt_P450_E_grp-IV  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG nhe:NECHADRAFT_51576  -  
Pfam View protein in Pfam  
PF00067  p450  
CDD cd11040  CYP7_CYP8-like  
Amino Acid Sequences MNATAITATASFVAETSSYGKVLVFLVLPCLLTYAYTSYGNRGYRHDLASREPPRVPYWVPVVGNTFGFAFDTEKFLFSAISKFGNVPLRLLIGAEPMYYIPHGQPILDLFKASRHLTTKSLGVMTIRNAFGCPPADVKIYADDESGTDAKPAPGWEHVDPSQRLHFVHHRDLHTLLAGSSLHALEEKFVESLSRSISNDSKFKKDEWTEVSDLYVLFRDYLFCAALEAFCGEKFLELSPDFPENFWVFDHHLPNLFKRLPKWLIPKSFRMRDKALGGVLRYHRYGREQFDFTDDNVLKGEWTPQFGSRLMRARQKMFLTTGFSVQGAAALDLGMLWGQVAFLSFHFVNANAIPASMWMLLGVLLDDNIKDRLMAEIDPAFTTSSLSFNKDKLCSGPLLNSIYCETLRVRVAAPVGRTSLIPDLKFGKWKLNQGVTMLSTSWIGGHDTKFWNTGREFPDGSVEHPVDSFWAERFLQYPDDPSSGPVRNPSFKAPFKTKRRTPEDDRNAQVITEGTQGYWYPYGGGTKMCPGRFFATQELKVGVAIMLRAYDIELLDHEAAAKIGPNMDYFPFGTIPPNGKVAARIRRRKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.11
4 0.12
5 0.12
6 0.12
7 0.12
8 0.12
9 0.13
10 0.13
11 0.11
12 0.1
13 0.13
14 0.13
15 0.14
16 0.12
17 0.13
18 0.11
19 0.1
20 0.11
21 0.11
22 0.13
23 0.16
24 0.17
25 0.2
26 0.27
27 0.31
28 0.31
29 0.34
30 0.38
31 0.4
32 0.44
33 0.44
34 0.41
35 0.43
36 0.51
37 0.51
38 0.48
39 0.46
40 0.45
41 0.43
42 0.45
43 0.41
44 0.35
45 0.37
46 0.38
47 0.37
48 0.35
49 0.36
50 0.33
51 0.31
52 0.26
53 0.21
54 0.14
55 0.14
56 0.13
57 0.11
58 0.1
59 0.15
60 0.15
61 0.15
62 0.15
63 0.15
64 0.15
65 0.14
66 0.16
67 0.14
68 0.15
69 0.15
70 0.16
71 0.21
72 0.28
73 0.27
74 0.25
75 0.24
76 0.24
77 0.23
78 0.23
79 0.18
80 0.12
81 0.12
82 0.11
83 0.1
84 0.09
85 0.1
86 0.1
87 0.11
88 0.08
89 0.12
90 0.13
91 0.12
92 0.13
93 0.15
94 0.19
95 0.18
96 0.18
97 0.14
98 0.17
99 0.21
100 0.21
101 0.23
102 0.22
103 0.25
104 0.27
105 0.29
106 0.28
107 0.26
108 0.26
109 0.22
110 0.2
111 0.2
112 0.2
113 0.23
114 0.21
115 0.18
116 0.18
117 0.18
118 0.19
119 0.18
120 0.17
121 0.14
122 0.16
123 0.17
124 0.17
125 0.18
126 0.19
127 0.2
128 0.19
129 0.18
130 0.15
131 0.14
132 0.17
133 0.17
134 0.13
135 0.11
136 0.11
137 0.11
138 0.12
139 0.13
140 0.11
141 0.14
142 0.18
143 0.18
144 0.23
145 0.26
146 0.32
147 0.32
148 0.33
149 0.34
150 0.31
151 0.3
152 0.31
153 0.34
154 0.33
155 0.41
156 0.44
157 0.42
158 0.43
159 0.43
160 0.39
161 0.33
162 0.27
163 0.18
164 0.13
165 0.11
166 0.09
167 0.09
168 0.08
169 0.07
170 0.07
171 0.07
172 0.06
173 0.07
174 0.08
175 0.07
176 0.07
177 0.07
178 0.07
179 0.09
180 0.11
181 0.12
182 0.12
183 0.15
184 0.19
185 0.23
186 0.29
187 0.3
188 0.34
189 0.33
190 0.34
191 0.39
192 0.37
193 0.4
194 0.38
195 0.41
196 0.37
197 0.35
198 0.34
199 0.27
200 0.24
201 0.18
202 0.14
203 0.08
204 0.07
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.07
216 0.06
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.1
224 0.09
225 0.11
226 0.12
227 0.14
228 0.14
229 0.14
230 0.17
231 0.13
232 0.14
233 0.13
234 0.13
235 0.13
236 0.17
237 0.18
238 0.16
239 0.21
240 0.21
241 0.22
242 0.26
243 0.25
244 0.23
245 0.23
246 0.3
247 0.28
248 0.33
249 0.41
250 0.42
251 0.49
252 0.51
253 0.59
254 0.59
255 0.64
256 0.61
257 0.58
258 0.53
259 0.48
260 0.46
261 0.39
262 0.33
263 0.27
264 0.24
265 0.24
266 0.23
267 0.21
268 0.2
269 0.19
270 0.18
271 0.21
272 0.25
273 0.24
274 0.26
275 0.26
276 0.25
277 0.29
278 0.29
279 0.25
280 0.29
281 0.24
282 0.19
283 0.18
284 0.18
285 0.13
286 0.12
287 0.16
288 0.09
289 0.11
290 0.12
291 0.13
292 0.15
293 0.16
294 0.18
295 0.18
296 0.24
297 0.25
298 0.31
299 0.33
300 0.33
301 0.37
302 0.36
303 0.34
304 0.29
305 0.28
306 0.25
307 0.23
308 0.22
309 0.17
310 0.16
311 0.14
312 0.12
313 0.11
314 0.07
315 0.06
316 0.05
317 0.04
318 0.04
319 0.04
320 0.04
321 0.03
322 0.02
323 0.02
324 0.02
325 0.02
326 0.02
327 0.03
328 0.03
329 0.03
330 0.07
331 0.07
332 0.08
333 0.08
334 0.09
335 0.09
336 0.09
337 0.1
338 0.07
339 0.07
340 0.06
341 0.06
342 0.08
343 0.06
344 0.06
345 0.04
346 0.05
347 0.05
348 0.05
349 0.04
350 0.03
351 0.03
352 0.03
353 0.03
354 0.05
355 0.05
356 0.05
357 0.05
358 0.05
359 0.07
360 0.08
361 0.08
362 0.09
363 0.09
364 0.1
365 0.11
366 0.11
367 0.1
368 0.09
369 0.1
370 0.08
371 0.11
372 0.11
373 0.15
374 0.16
375 0.18
376 0.22
377 0.22
378 0.23
379 0.21
380 0.22
381 0.2
382 0.2
383 0.2
384 0.2
385 0.23
386 0.22
387 0.21
388 0.2
389 0.19
390 0.18
391 0.17
392 0.13
393 0.14
394 0.15
395 0.15
396 0.14
397 0.14
398 0.17
399 0.18
400 0.19
401 0.17
402 0.18
403 0.17
404 0.16
405 0.16
406 0.2
407 0.21
408 0.19
409 0.2
410 0.23
411 0.24
412 0.29
413 0.28
414 0.31
415 0.32
416 0.39
417 0.44
418 0.44
419 0.44
420 0.4
421 0.42
422 0.34
423 0.31
424 0.24
425 0.17
426 0.13
427 0.11
428 0.1
429 0.08
430 0.09
431 0.1
432 0.11
433 0.16
434 0.19
435 0.2
436 0.24
437 0.24
438 0.27
439 0.25
440 0.32
441 0.3
442 0.32
443 0.32
444 0.28
445 0.34
446 0.3
447 0.3
448 0.29
449 0.26
450 0.22
451 0.21
452 0.2
453 0.14
454 0.15
455 0.14
456 0.08
457 0.12
458 0.12
459 0.13
460 0.14
461 0.16
462 0.18
463 0.18
464 0.21
465 0.2
466 0.22
467 0.22
468 0.23
469 0.27
470 0.25
471 0.26
472 0.29
473 0.32
474 0.35
475 0.37
476 0.42
477 0.45
478 0.48
479 0.54
480 0.58
481 0.62
482 0.68
483 0.76
484 0.76
485 0.78
486 0.81
487 0.83
488 0.82
489 0.83
490 0.83
491 0.81
492 0.78
493 0.7
494 0.62
495 0.53
496 0.44
497 0.33
498 0.25
499 0.19
500 0.15
501 0.12
502 0.13
503 0.13
504 0.15
505 0.15
506 0.13
507 0.11
508 0.12
509 0.14
510 0.14
511 0.16
512 0.14
513 0.22
514 0.28
515 0.28
516 0.28
517 0.3
518 0.33
519 0.35
520 0.38
521 0.38
522 0.41
523 0.41
524 0.43
525 0.4
526 0.36
527 0.32
528 0.28
529 0.2
530 0.12
531 0.11
532 0.08
533 0.07
534 0.07
535 0.07
536 0.07
537 0.08
538 0.07
539 0.08
540 0.08
541 0.12
542 0.12
543 0.12
544 0.12
545 0.11
546 0.11
547 0.11
548 0.12
549 0.08
550 0.11
551 0.12
552 0.12
553 0.15
554 0.16
555 0.18
556 0.17
557 0.19
558 0.18
559 0.17
560 0.2
561 0.22
562 0.26
563 0.25
564 0.27
565 0.26
566 0.25
567 0.31
568 0.36
569 0.42
570 0.48
571 0.56