Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D219

Protein Details
Accession A0A1B8D219    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
86-113DSASNISSSRHRRPKRRNERRTPALVEEHydrophilic
NLS Segment(s)
PositionSequence
95-106RHRRPKRRNERR
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MEALEDAFEALHRKAEVVRQAVRHRGAGLAMAAQSRRGGVGIGVRAATPGGESAAGGWGGGNGGGWQGEESESGSDVGDVEIAPDDSASNISSSRHRRPKRRNERRTPALVEEEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.26
4 0.29
5 0.33
6 0.37
7 0.42
8 0.48
9 0.49
10 0.44
11 0.38
12 0.33
13 0.29
14 0.23
15 0.18
16 0.12
17 0.11
18 0.11
19 0.1
20 0.1
21 0.1
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.09
28 0.09
29 0.1
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.05
36 0.04
37 0.04
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.05
70 0.04
71 0.04
72 0.04
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.08
79 0.16
80 0.23
81 0.34
82 0.44
83 0.52
84 0.63
85 0.73
86 0.83
87 0.87
88 0.92
89 0.93
90 0.93
91 0.95
92 0.93
93 0.91
94 0.85
95 0.8
96 0.75
97 0.65