Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D4P6

Protein Details
Accession A0A1B8D4P6   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
248-270AVPAMSKRKAKKLKLEALKASKEHydrophilic
NLS Segment(s)
PositionSequence
253-264SKRKAKKLKLEA
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, mito 6, nucl 5.5, extr 3, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016195  Pol/histidinol_Pase-like  
IPR002738  RNase_P_p30  
Gene Ontology GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01876  RNase_P_p30  
Amino Acid Sequences MLYDLCIPWTNDTQSLQRVLSFLSELNYSVIALDHSITGAIPSKIVSPVPSPAPFPTPPNLKILTRCTITLSDPSHNHRLPSLAQAYDILAVRPTTEKAFLAACLTLTDAALISLDLTQRFPFHFRPKPLMTAVKRGVRIELCYSQALQGGSVDRRNVIMNVQSIVRARQGGGLVVEQRSKKRAGPVEAQTINPRSVVVNETIKRTGFRGVVDVVDGGRKPESEKAISKEAANGQANGKRKNEQAEEAVPAMSKRKAKKLKLEALKASKEATPGSATPPSKDSVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.32
4 0.28
5 0.26
6 0.23
7 0.22
8 0.18
9 0.15
10 0.13
11 0.13
12 0.13
13 0.13
14 0.13
15 0.11
16 0.1
17 0.09
18 0.08
19 0.08
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.07
26 0.1
27 0.1
28 0.09
29 0.1
30 0.11
31 0.13
32 0.14
33 0.15
34 0.13
35 0.17
36 0.22
37 0.22
38 0.23
39 0.23
40 0.28
41 0.28
42 0.29
43 0.32
44 0.34
45 0.34
46 0.37
47 0.38
48 0.35
49 0.39
50 0.41
51 0.39
52 0.34
53 0.33
54 0.31
55 0.3
56 0.29
57 0.3
58 0.28
59 0.29
60 0.31
61 0.36
62 0.42
63 0.41
64 0.39
65 0.34
66 0.33
67 0.28
68 0.32
69 0.29
70 0.21
71 0.2
72 0.2
73 0.2
74 0.19
75 0.18
76 0.11
77 0.09
78 0.08
79 0.09
80 0.1
81 0.11
82 0.09
83 0.11
84 0.11
85 0.11
86 0.12
87 0.11
88 0.11
89 0.1
90 0.09
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.04
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.05
103 0.05
104 0.06
105 0.07
106 0.08
107 0.09
108 0.12
109 0.17
110 0.25
111 0.31
112 0.33
113 0.4
114 0.41
115 0.43
116 0.43
117 0.46
118 0.39
119 0.41
120 0.43
121 0.4
122 0.4
123 0.37
124 0.36
125 0.28
126 0.28
127 0.24
128 0.21
129 0.18
130 0.17
131 0.17
132 0.15
133 0.16
134 0.14
135 0.11
136 0.09
137 0.09
138 0.1
139 0.12
140 0.11
141 0.09
142 0.1
143 0.11
144 0.1
145 0.1
146 0.11
147 0.11
148 0.11
149 0.11
150 0.12
151 0.12
152 0.12
153 0.12
154 0.1
155 0.09
156 0.1
157 0.11
158 0.1
159 0.1
160 0.11
161 0.11
162 0.12
163 0.15
164 0.15
165 0.16
166 0.18
167 0.19
168 0.2
169 0.26
170 0.31
171 0.33
172 0.39
173 0.42
174 0.49
175 0.48
176 0.48
177 0.44
178 0.4
179 0.35
180 0.28
181 0.23
182 0.15
183 0.15
184 0.15
185 0.15
186 0.2
187 0.21
188 0.25
189 0.26
190 0.26
191 0.26
192 0.25
193 0.26
194 0.2
195 0.19
196 0.18
197 0.17
198 0.17
199 0.17
200 0.16
201 0.12
202 0.12
203 0.12
204 0.1
205 0.1
206 0.1
207 0.12
208 0.17
209 0.21
210 0.24
211 0.29
212 0.32
213 0.38
214 0.39
215 0.37
216 0.37
217 0.36
218 0.39
219 0.35
220 0.32
221 0.3
222 0.34
223 0.4
224 0.4
225 0.4
226 0.36
227 0.38
228 0.44
229 0.44
230 0.44
231 0.43
232 0.41
233 0.41
234 0.38
235 0.35
236 0.27
237 0.24
238 0.23
239 0.23
240 0.26
241 0.28
242 0.38
243 0.48
244 0.55
245 0.65
246 0.72
247 0.78
248 0.81
249 0.84
250 0.83
251 0.82
252 0.78
253 0.69
254 0.6
255 0.52
256 0.44
257 0.37
258 0.29
259 0.25
260 0.22
261 0.26
262 0.32
263 0.31
264 0.31
265 0.33
266 0.33