Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CUX5

Protein Details
Accession A0A1B8CUX5   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-123MGPGIATKRRRRREQMEEEDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008828  Sin1/Avo1  
Gene Ontology GO:0031932  C:TORC2 complex  
Amino Acid Sequences MSVIQVEDLVSYQLRSNYLNTVKDGVGERLITLNDAFLNTPGFKAAGWRQNPSHVKRTHSPPIPTAITSEYFKAPRFGLRPGSSHDEFEEGGMVTGEGAGDTMGPGIATKRRRRREQMEEEDSSDLSDDSDEEEQRAAQQIKFAKMPVRLRSGSSPIRNSNSKSSPNLTSPPRQPGARRGSQSAVEAVKERARRDTVTSSEMSSENEFDNSGFKRQQAQGKVPAKAGRRVDTSQDEMEDYSYVSDMSSAFGDSVDSQSISGSVEGSHIYVFKPPRCWNAASQFGKDVSQEIKASAGNPTSTPTSPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.25
5 0.31
6 0.33
7 0.32
8 0.33
9 0.31
10 0.33
11 0.34
12 0.27
13 0.24
14 0.22
15 0.2
16 0.19
17 0.19
18 0.17
19 0.14
20 0.13
21 0.11
22 0.11
23 0.11
24 0.1
25 0.13
26 0.12
27 0.12
28 0.12
29 0.11
30 0.1
31 0.16
32 0.22
33 0.28
34 0.31
35 0.36
36 0.37
37 0.47
38 0.56
39 0.56
40 0.58
41 0.53
42 0.57
43 0.59
44 0.66
45 0.66
46 0.65
47 0.62
48 0.55
49 0.58
50 0.54
51 0.46
52 0.4
53 0.33
54 0.28
55 0.26
56 0.25
57 0.22
58 0.22
59 0.22
60 0.23
61 0.21
62 0.24
63 0.25
64 0.27
65 0.32
66 0.32
67 0.34
68 0.37
69 0.43
70 0.38
71 0.37
72 0.33
73 0.27
74 0.24
75 0.22
76 0.18
77 0.1
78 0.09
79 0.08
80 0.07
81 0.05
82 0.05
83 0.04
84 0.03
85 0.03
86 0.02
87 0.02
88 0.02
89 0.03
90 0.02
91 0.03
92 0.03
93 0.05
94 0.1
95 0.18
96 0.27
97 0.37
98 0.46
99 0.55
100 0.64
101 0.71
102 0.77
103 0.8
104 0.81
105 0.78
106 0.71
107 0.65
108 0.57
109 0.48
110 0.37
111 0.26
112 0.16
113 0.09
114 0.07
115 0.05
116 0.06
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.13
124 0.12
125 0.11
126 0.14
127 0.17
128 0.19
129 0.2
130 0.2
131 0.2
132 0.25
133 0.3
134 0.3
135 0.33
136 0.31
137 0.33
138 0.34
139 0.36
140 0.36
141 0.34
142 0.34
143 0.32
144 0.35
145 0.36
146 0.36
147 0.37
148 0.36
149 0.36
150 0.34
151 0.34
152 0.33
153 0.33
154 0.36
155 0.33
156 0.34
157 0.34
158 0.37
159 0.37
160 0.36
161 0.35
162 0.39
163 0.43
164 0.43
165 0.42
166 0.39
167 0.38
168 0.38
169 0.37
170 0.31
171 0.24
172 0.18
173 0.18
174 0.17
175 0.19
176 0.2
177 0.2
178 0.21
179 0.23
180 0.24
181 0.27
182 0.31
183 0.29
184 0.3
185 0.3
186 0.26
187 0.26
188 0.25
189 0.22
190 0.17
191 0.15
192 0.12
193 0.12
194 0.11
195 0.1
196 0.13
197 0.13
198 0.16
199 0.16
200 0.16
201 0.22
202 0.27
203 0.34
204 0.36
205 0.4
206 0.46
207 0.51
208 0.52
209 0.5
210 0.51
211 0.47
212 0.48
213 0.47
214 0.42
215 0.41
216 0.41
217 0.43
218 0.42
219 0.43
220 0.37
221 0.33
222 0.3
223 0.25
224 0.24
225 0.18
226 0.13
227 0.09
228 0.08
229 0.07
230 0.06
231 0.06
232 0.05
233 0.06
234 0.07
235 0.06
236 0.06
237 0.06
238 0.07
239 0.08
240 0.09
241 0.09
242 0.09
243 0.09
244 0.09
245 0.09
246 0.09
247 0.08
248 0.07
249 0.06
250 0.07
251 0.07
252 0.08
253 0.08
254 0.08
255 0.08
256 0.14
257 0.2
258 0.23
259 0.31
260 0.35
261 0.42
262 0.46
263 0.49
264 0.51
265 0.54
266 0.6
267 0.56
268 0.54
269 0.51
270 0.47
271 0.45
272 0.38
273 0.32
274 0.24
275 0.24
276 0.22
277 0.19
278 0.2
279 0.19
280 0.2
281 0.21
282 0.22
283 0.19
284 0.19
285 0.22
286 0.24
287 0.24