Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D502

Protein Details
Accession A0A1B8D502   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-65QSHRACVRKGRQHPRRAPRPTABasic
NLS Segment(s)
PositionSequence
51-67RKGRQHPRRAPRPTAAR
Subcellular Location(s) cyto 9.5, cyto_nucl 7.5, plas 5, nucl 4.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016039  Thiolase-like  
Gene Ontology GO:0016020  C:membrane  
GO:0016746  F:acyltransferase activity  
Amino Acid Sequences MSSGFKDTAGREAEEGGVQYEDPKTDHGDKGRQRARGHHGQVAQSHRACVRKGRQHPRRAPRPTAARLGPRVLGKYVTATVVGVALLLMGVGPWAAVPLAIEKTGITKEAVDGWEINKRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.13
4 0.11
5 0.1
6 0.11
7 0.1
8 0.1
9 0.1
10 0.11
11 0.15
12 0.19
13 0.23
14 0.27
15 0.35
16 0.39
17 0.49
18 0.53
19 0.54
20 0.52
21 0.56
22 0.59
23 0.6
24 0.58
25 0.53
26 0.51
27 0.47
28 0.51
29 0.48
30 0.46
31 0.36
32 0.34
33 0.31
34 0.31
35 0.28
36 0.31
37 0.34
38 0.38
39 0.48
40 0.58
41 0.64
42 0.71
43 0.8
44 0.83
45 0.84
46 0.81
47 0.76
48 0.72
49 0.71
50 0.64
51 0.6
52 0.53
53 0.47
54 0.43
55 0.4
56 0.36
57 0.29
58 0.27
59 0.22
60 0.19
61 0.15
62 0.15
63 0.14
64 0.11
65 0.1
66 0.09
67 0.08
68 0.07
69 0.07
70 0.04
71 0.04
72 0.03
73 0.02
74 0.02
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.03
85 0.06
86 0.07
87 0.08
88 0.08
89 0.08
90 0.11
91 0.12
92 0.13
93 0.11
94 0.1
95 0.11
96 0.15
97 0.16
98 0.15
99 0.16
100 0.17
101 0.24