Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D480

Protein Details
Accession A0A1B8D480   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
145-178YPMHIREDGRWKKKKREKRSRRRKEEEERQENGSBasic
NLS Segment(s)
PositionSequence
153-168GRWKKKKREKRSRRRK
Subcellular Location(s) nucl 16, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005365  Npr3  
Gene Ontology GO:0005774  C:vacuolar membrane  
GO:0051321  P:meiotic cell cycle  
GO:0032007  P:negative regulation of TOR signaling  
Pfam View protein in Pfam  
PF03666  NPR3  
Amino Acid Sequences MSVDSSLLGVALIVRSKDGPRFIFHYPPRLKPNERTIRPPYGTELDPTAPEDADDIEPDADDELDDRDYSLYNSLEGLGLGKKSRHVNPWEGDDHFELPDGQHVVPWEYLDAFHTKDLASILTPARAFHKRCFELTLDPLTFVTYPMHIREDGRWKKKKREKRSRRRKEEEERQENGSIADDTAISESPAETPGWTTRRETSGSRKGHLSRLTTLMMAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.14
4 0.19
5 0.24
6 0.25
7 0.27
8 0.32
9 0.35
10 0.43
11 0.43
12 0.5
13 0.49
14 0.55
15 0.59
16 0.62
17 0.64
18 0.62
19 0.7
20 0.7
21 0.69
22 0.69
23 0.68
24 0.7
25 0.66
26 0.6
27 0.54
28 0.48
29 0.45
30 0.38
31 0.34
32 0.26
33 0.24
34 0.24
35 0.2
36 0.15
37 0.14
38 0.12
39 0.11
40 0.1
41 0.1
42 0.09
43 0.08
44 0.08
45 0.08
46 0.08
47 0.06
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.1
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.08
65 0.06
66 0.07
67 0.08
68 0.08
69 0.12
70 0.16
71 0.2
72 0.25
73 0.29
74 0.34
75 0.35
76 0.4
77 0.39
78 0.35
79 0.34
80 0.29
81 0.26
82 0.19
83 0.17
84 0.12
85 0.09
86 0.11
87 0.1
88 0.09
89 0.08
90 0.09
91 0.1
92 0.1
93 0.1
94 0.08
95 0.06
96 0.06
97 0.07
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.08
105 0.07
106 0.06
107 0.07
108 0.08
109 0.09
110 0.09
111 0.09
112 0.14
113 0.19
114 0.22
115 0.24
116 0.33
117 0.33
118 0.34
119 0.37
120 0.34
121 0.32
122 0.33
123 0.33
124 0.24
125 0.23
126 0.22
127 0.2
128 0.18
129 0.15
130 0.12
131 0.09
132 0.1
133 0.11
134 0.13
135 0.13
136 0.14
137 0.18
138 0.29
139 0.37
140 0.46
141 0.54
142 0.58
143 0.68
144 0.77
145 0.83
146 0.84
147 0.86
148 0.87
149 0.89
150 0.95
151 0.95
152 0.96
153 0.95
154 0.94
155 0.94
156 0.93
157 0.93
158 0.9
159 0.82
160 0.75
161 0.67
162 0.56
163 0.46
164 0.36
165 0.25
166 0.17
167 0.14
168 0.09
169 0.08
170 0.09
171 0.09
172 0.07
173 0.07
174 0.07
175 0.07
176 0.09
177 0.09
178 0.08
179 0.1
180 0.17
181 0.2
182 0.22
183 0.24
184 0.27
185 0.31
186 0.34
187 0.37
188 0.41
189 0.48
190 0.51
191 0.5
192 0.53
193 0.53
194 0.58
195 0.58
196 0.53
197 0.48
198 0.47
199 0.46