Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8DGI9

Protein Details
Accession A0A1B8DGI9   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
70-89VIEGTKKPQRSHKTNPKQCTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 5.5, cyto_pero 4.5, nucl 3, pero 2.5
Family & Domain DBs
Amino Acid Sequences MPSILTAREWRDTFSGPFIGTKGGSRTQCRPAQKEDSDILATCQTPDVLTMYWQARYVALVPETDLVVHVIEGTKKPQRSHKTNPKQCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.22
4 0.22
5 0.2
6 0.18
7 0.16
8 0.16
9 0.16
10 0.2
11 0.24
12 0.27
13 0.32
14 0.38
15 0.43
16 0.48
17 0.48
18 0.49
19 0.53
20 0.5
21 0.49
22 0.43
23 0.4
24 0.34
25 0.3
26 0.25
27 0.17
28 0.16
29 0.11
30 0.1
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.1
38 0.1
39 0.11
40 0.12
41 0.12
42 0.1
43 0.11
44 0.12
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.08
59 0.1
60 0.15
61 0.22
62 0.26
63 0.3
64 0.4
65 0.49
66 0.56
67 0.66
68 0.72
69 0.77