Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7Z0F3

Protein Details
Accession C7Z0F3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
26-56HAACQGWKAHKKPRGQKRRRGLPPLKKTTYEBasic
NLS Segment(s)
PositionSequence
32-51WKAHKKPRGQKRRRGLPPLK
Subcellular Location(s) mito 13, plas 7, mito_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
KEGG nhe:NECHADRAFT_79873  -  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MPKEWRFVVSNRPSALKAKAASIRGHAACQGWKAHKKPRGQKRRRGLPPLKKTTYEYVAVDMPSCWFPPIEYQLGGGRVDPFRAYPGSQHPAIPALVDHYLIHMAVNIPELDQPGNAGLLRSSWFPLVISNECPFKVILLLAASNAVAINYKPYASCDLVQLHTNAIKAINNAFDSNEKRVCDALIGAVAKMASFEAMHGDVGSYRIHMEGLCKMIALRGGLDQLGLDGLLRRIVVWIDINSSFLLQIPRYFPQDGFVVGEDFYRAGGLDEISSLLLKDGGILPYSLSHCRMPRHPYYLEDPVEEVLLLMYRQDLHEHTLRSLVAVRPLIEAAKSSMDCSSSVRFASCQGLQVTHLRQFRKINISRSSTVLQAIMAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.44
4 0.37
5 0.37
6 0.41
7 0.42
8 0.42
9 0.42
10 0.46
11 0.4
12 0.4
13 0.35
14 0.32
15 0.31
16 0.32
17 0.35
18 0.36
19 0.43
20 0.48
21 0.56
22 0.59
23 0.67
24 0.73
25 0.78
26 0.8
27 0.82
28 0.86
29 0.87
30 0.92
31 0.91
32 0.92
33 0.92
34 0.91
35 0.92
36 0.92
37 0.86
38 0.78
39 0.73
40 0.69
41 0.62
42 0.55
43 0.45
44 0.37
45 0.34
46 0.31
47 0.27
48 0.21
49 0.18
50 0.16
51 0.15
52 0.13
53 0.1
54 0.11
55 0.16
56 0.21
57 0.22
58 0.2
59 0.22
60 0.24
61 0.26
62 0.25
63 0.2
64 0.19
65 0.16
66 0.17
67 0.16
68 0.14
69 0.15
70 0.16
71 0.16
72 0.17
73 0.24
74 0.28
75 0.28
76 0.28
77 0.26
78 0.26
79 0.26
80 0.22
81 0.14
82 0.12
83 0.11
84 0.11
85 0.1
86 0.09
87 0.1
88 0.09
89 0.09
90 0.07
91 0.07
92 0.07
93 0.08
94 0.07
95 0.07
96 0.08
97 0.09
98 0.09
99 0.08
100 0.08
101 0.07
102 0.08
103 0.07
104 0.07
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.1
114 0.13
115 0.14
116 0.16
117 0.17
118 0.19
119 0.18
120 0.19
121 0.17
122 0.13
123 0.12
124 0.09
125 0.08
126 0.07
127 0.07
128 0.06
129 0.07
130 0.06
131 0.06
132 0.05
133 0.04
134 0.04
135 0.04
136 0.06
137 0.06
138 0.06
139 0.06
140 0.08
141 0.12
142 0.13
143 0.14
144 0.15
145 0.17
146 0.18
147 0.19
148 0.18
149 0.15
150 0.15
151 0.14
152 0.12
153 0.1
154 0.1
155 0.1
156 0.1
157 0.11
158 0.1
159 0.1
160 0.11
161 0.14
162 0.15
163 0.19
164 0.2
165 0.19
166 0.19
167 0.19
168 0.18
169 0.14
170 0.12
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.05
180 0.03
181 0.03
182 0.03
183 0.04
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.06
190 0.06
191 0.05
192 0.05
193 0.05
194 0.06
195 0.06
196 0.07
197 0.08
198 0.1
199 0.09
200 0.09
201 0.09
202 0.09
203 0.1
204 0.09
205 0.07
206 0.06
207 0.07
208 0.07
209 0.07
210 0.06
211 0.05
212 0.04
213 0.04
214 0.03
215 0.03
216 0.04
217 0.04
218 0.04
219 0.05
220 0.05
221 0.05
222 0.06
223 0.07
224 0.08
225 0.1
226 0.1
227 0.11
228 0.11
229 0.11
230 0.1
231 0.1
232 0.11
233 0.09
234 0.11
235 0.13
236 0.15
237 0.19
238 0.2
239 0.18
240 0.19
241 0.19
242 0.18
243 0.16
244 0.15
245 0.12
246 0.11
247 0.11
248 0.09
249 0.08
250 0.07
251 0.06
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.06
261 0.05
262 0.05
263 0.05
264 0.05
265 0.05
266 0.07
267 0.08
268 0.08
269 0.08
270 0.08
271 0.11
272 0.14
273 0.15
274 0.16
275 0.19
276 0.22
277 0.27
278 0.33
279 0.37
280 0.41
281 0.46
282 0.46
283 0.46
284 0.49
285 0.52
286 0.48
287 0.41
288 0.35
289 0.29
290 0.27
291 0.23
292 0.16
293 0.08
294 0.07
295 0.06
296 0.05
297 0.05
298 0.06
299 0.07
300 0.09
301 0.1
302 0.15
303 0.2
304 0.22
305 0.22
306 0.24
307 0.24
308 0.23
309 0.25
310 0.22
311 0.23
312 0.23
313 0.23
314 0.22
315 0.23
316 0.22
317 0.18
318 0.18
319 0.14
320 0.17
321 0.17
322 0.17
323 0.17
324 0.18
325 0.18
326 0.2
327 0.22
328 0.19
329 0.2
330 0.21
331 0.2
332 0.21
333 0.26
334 0.24
335 0.25
336 0.24
337 0.24
338 0.25
339 0.31
340 0.33
341 0.35
342 0.39
343 0.37
344 0.41
345 0.46
346 0.51
347 0.56
348 0.58
349 0.59
350 0.63
351 0.68
352 0.64
353 0.63
354 0.57
355 0.48
356 0.43
357 0.35