Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CW64

Protein Details
Accession A0A1B8CW64    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
85-104AYPLSKRILRPRNPRDQAREHydrophilic
NLS Segment(s)
PositionSequence
185-194RGRGRPPKNK
Subcellular Location(s) cyto_nucl 14.333, nucl 12.5, cyto 11, cyto_mito 8.165
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MAVGPFSEYEQRFLLTEILKTSNIPIDALLNVLREQNFDPTWEEVGLPAGRSMNSCAAELAKLNSGLNGDAIPEQDQTDISRNQAYPLSKRILRPRNPRDQAREIKPKPAAAASNGADKLVTSTPATGSARKRGRPSNAELAQRAKEASERGEAEKGVYATKRKSISDQSVGEPAAPGAVPPAERGRGRPPKNKAPVANPGVDVEEESKPSEADTDVAAPANPEPEPVVNDKIPQDDAATKETRQNLEVVARAASATVSEALAPQPQIAPSNTPAPTTSAFKKIFGLSSQTPTTQVPPPEQAIGAAAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.21
4 0.21
5 0.23
6 0.22
7 0.22
8 0.23
9 0.23
10 0.21
11 0.2
12 0.17
13 0.15
14 0.15
15 0.16
16 0.15
17 0.12
18 0.12
19 0.15
20 0.15
21 0.16
22 0.17
23 0.21
24 0.2
25 0.21
26 0.23
27 0.22
28 0.23
29 0.21
30 0.2
31 0.14
32 0.18
33 0.17
34 0.15
35 0.13
36 0.13
37 0.13
38 0.14
39 0.17
40 0.18
41 0.18
42 0.18
43 0.18
44 0.17
45 0.18
46 0.18
47 0.17
48 0.14
49 0.13
50 0.13
51 0.13
52 0.13
53 0.12
54 0.12
55 0.09
56 0.08
57 0.08
58 0.09
59 0.09
60 0.09
61 0.1
62 0.09
63 0.1
64 0.11
65 0.15
66 0.15
67 0.16
68 0.2
69 0.19
70 0.21
71 0.25
72 0.25
73 0.24
74 0.28
75 0.32
76 0.31
77 0.36
78 0.45
79 0.5
80 0.57
81 0.65
82 0.69
83 0.74
84 0.78
85 0.8
86 0.78
87 0.78
88 0.77
89 0.75
90 0.77
91 0.68
92 0.68
93 0.63
94 0.56
95 0.47
96 0.41
97 0.34
98 0.25
99 0.29
100 0.22
101 0.25
102 0.24
103 0.22
104 0.19
105 0.18
106 0.18
107 0.13
108 0.13
109 0.08
110 0.08
111 0.09
112 0.13
113 0.15
114 0.17
115 0.19
116 0.27
117 0.32
118 0.35
119 0.4
120 0.41
121 0.47
122 0.48
123 0.51
124 0.52
125 0.52
126 0.52
127 0.48
128 0.46
129 0.4
130 0.35
131 0.29
132 0.19
133 0.15
134 0.13
135 0.13
136 0.13
137 0.14
138 0.15
139 0.16
140 0.16
141 0.14
142 0.15
143 0.13
144 0.11
145 0.12
146 0.13
147 0.13
148 0.18
149 0.2
150 0.19
151 0.22
152 0.27
153 0.31
154 0.34
155 0.35
156 0.32
157 0.32
158 0.31
159 0.28
160 0.22
161 0.16
162 0.1
163 0.08
164 0.06
165 0.04
166 0.05
167 0.05
168 0.06
169 0.08
170 0.11
171 0.12
172 0.15
173 0.25
174 0.34
175 0.41
176 0.48
177 0.54
178 0.61
179 0.69
180 0.72
181 0.66
182 0.62
183 0.64
184 0.59
185 0.54
186 0.44
187 0.36
188 0.31
189 0.27
190 0.22
191 0.16
192 0.13
193 0.12
194 0.12
195 0.12
196 0.11
197 0.11
198 0.11
199 0.08
200 0.08
201 0.08
202 0.08
203 0.09
204 0.09
205 0.09
206 0.08
207 0.08
208 0.09
209 0.08
210 0.07
211 0.08
212 0.09
213 0.11
214 0.14
215 0.18
216 0.17
217 0.2
218 0.21
219 0.22
220 0.22
221 0.2
222 0.19
223 0.18
224 0.19
225 0.22
226 0.23
227 0.22
228 0.26
229 0.3
230 0.3
231 0.27
232 0.26
233 0.24
234 0.25
235 0.26
236 0.22
237 0.17
238 0.16
239 0.15
240 0.14
241 0.11
242 0.08
243 0.07
244 0.06
245 0.06
246 0.06
247 0.07
248 0.08
249 0.1
250 0.1
251 0.1
252 0.11
253 0.12
254 0.15
255 0.15
256 0.18
257 0.19
258 0.26
259 0.26
260 0.26
261 0.26
262 0.26
263 0.28
264 0.3
265 0.31
266 0.33
267 0.34
268 0.34
269 0.36
270 0.35
271 0.35
272 0.32
273 0.35
274 0.3
275 0.35
276 0.37
277 0.34
278 0.34
279 0.32
280 0.34
281 0.33
282 0.33
283 0.31
284 0.33
285 0.36
286 0.35
287 0.34
288 0.3