Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CUX8

Protein Details
Accession A0A1B8CUX8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
169-191KPLSVARKPQKKKKPVITPKTAEHydrophilic
NLS Segment(s)
PositionSequence
174-183ARKPQKKKKP
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018800  PRCC  
Pfam View protein in Pfam  
PF10253  PRCC  
Amino Acid Sequences MGLVDYSDSESSDNEQVSETKKPSKGSFQKVVDRSNPGKIKVSLPTTTAPTNDEPPAKRAKTSGGGAFGGFNSFLPAPKKTGAAAPKTLGGGATANGRGGGLGSGVSLKTGAAPAFSRNPEPVYDGGDNYDGHDEAKGGESSMGLPPPNASAQIPAADVKLVGKPLMFKPLSVARKPQKKKKPVITPKTAEGPASQGPSEMSEAPKAPQPKVSLFSVPQDADDNIAPERKGEYQPMLYGAKPEEKEEPEVVKNPYYEDQYNDAESRHTVPRPAAPAAAPASTTSNSLDNIASDLQLSASERRQLFGRQGARNLTASKVINFNTDEEYRNNEELRSAGEQAVHNPVRSIAPGKHSLKQLLNATVSQKEALEESFAKGYANRKEASGRYGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.19
4 0.22
5 0.29
6 0.29
7 0.33
8 0.37
9 0.42
10 0.45
11 0.53
12 0.59
13 0.62
14 0.67
15 0.66
16 0.72
17 0.73
18 0.76
19 0.7
20 0.69
21 0.63
22 0.63
23 0.6
24 0.54
25 0.55
26 0.5
27 0.49
28 0.48
29 0.5
30 0.42
31 0.39
32 0.39
33 0.37
34 0.36
35 0.33
36 0.29
37 0.27
38 0.29
39 0.31
40 0.35
41 0.33
42 0.35
43 0.44
44 0.41
45 0.4
46 0.37
47 0.38
48 0.38
49 0.4
50 0.4
51 0.34
52 0.33
53 0.32
54 0.31
55 0.25
56 0.2
57 0.15
58 0.11
59 0.1
60 0.1
61 0.13
62 0.15
63 0.17
64 0.19
65 0.21
66 0.22
67 0.2
68 0.26
69 0.3
70 0.32
71 0.34
72 0.32
73 0.32
74 0.31
75 0.3
76 0.23
77 0.17
78 0.13
79 0.1
80 0.12
81 0.1
82 0.1
83 0.1
84 0.09
85 0.08
86 0.08
87 0.07
88 0.04
89 0.04
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.07
98 0.06
99 0.07
100 0.08
101 0.11
102 0.17
103 0.18
104 0.19
105 0.19
106 0.21
107 0.2
108 0.22
109 0.2
110 0.2
111 0.2
112 0.18
113 0.18
114 0.18
115 0.17
116 0.16
117 0.16
118 0.11
119 0.1
120 0.1
121 0.09
122 0.07
123 0.1
124 0.08
125 0.07
126 0.08
127 0.07
128 0.09
129 0.1
130 0.11
131 0.08
132 0.08
133 0.09
134 0.1
135 0.1
136 0.1
137 0.09
138 0.09
139 0.09
140 0.1
141 0.11
142 0.1
143 0.09
144 0.08
145 0.08
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.09
152 0.1
153 0.18
154 0.17
155 0.16
156 0.19
157 0.27
158 0.32
159 0.3
160 0.38
161 0.37
162 0.48
163 0.55
164 0.62
165 0.64
166 0.69
167 0.77
168 0.78
169 0.82
170 0.82
171 0.84
172 0.83
173 0.76
174 0.69
175 0.65
176 0.56
177 0.45
178 0.34
179 0.29
180 0.21
181 0.2
182 0.17
183 0.12
184 0.11
185 0.12
186 0.13
187 0.1
188 0.09
189 0.09
190 0.1
191 0.11
192 0.14
193 0.15
194 0.14
195 0.17
196 0.19
197 0.2
198 0.23
199 0.23
200 0.23
201 0.22
202 0.23
203 0.23
204 0.2
205 0.18
206 0.17
207 0.15
208 0.14
209 0.13
210 0.12
211 0.09
212 0.11
213 0.1
214 0.09
215 0.11
216 0.13
217 0.14
218 0.15
219 0.17
220 0.17
221 0.17
222 0.2
223 0.2
224 0.17
225 0.17
226 0.16
227 0.19
228 0.19
229 0.2
230 0.21
231 0.22
232 0.25
233 0.25
234 0.27
235 0.24
236 0.28
237 0.28
238 0.26
239 0.24
240 0.23
241 0.24
242 0.24
243 0.23
244 0.22
245 0.24
246 0.23
247 0.25
248 0.24
249 0.21
250 0.18
251 0.18
252 0.19
253 0.2
254 0.19
255 0.19
256 0.2
257 0.24
258 0.27
259 0.27
260 0.24
261 0.2
262 0.23
263 0.22
264 0.21
265 0.17
266 0.14
267 0.15
268 0.15
269 0.16
270 0.13
271 0.13
272 0.13
273 0.14
274 0.13
275 0.11
276 0.12
277 0.11
278 0.1
279 0.09
280 0.08
281 0.07
282 0.08
283 0.1
284 0.11
285 0.13
286 0.19
287 0.19
288 0.2
289 0.22
290 0.24
291 0.27
292 0.33
293 0.39
294 0.37
295 0.41
296 0.44
297 0.44
298 0.44
299 0.4
300 0.34
301 0.31
302 0.28
303 0.26
304 0.26
305 0.24
306 0.26
307 0.26
308 0.26
309 0.25
310 0.26
311 0.27
312 0.24
313 0.3
314 0.31
315 0.32
316 0.32
317 0.27
318 0.25
319 0.23
320 0.25
321 0.22
322 0.19
323 0.18
324 0.21
325 0.21
326 0.23
327 0.32
328 0.29
329 0.26
330 0.25
331 0.25
332 0.23
333 0.24
334 0.26
335 0.21
336 0.25
337 0.34
338 0.38
339 0.42
340 0.46
341 0.5
342 0.49
343 0.52
344 0.52
345 0.48
346 0.47
347 0.43
348 0.42
349 0.38
350 0.36
351 0.3
352 0.24
353 0.2
354 0.18
355 0.16
356 0.18
357 0.17
358 0.18
359 0.19
360 0.19
361 0.18
362 0.2
363 0.27
364 0.3
365 0.34
366 0.32
367 0.33
368 0.4
369 0.42