Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8CYY8

Protein Details
Accession A0A1B8CYY8    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-25REPVLDPKKRSKLRVDENHGLBasic
150-186ELEEPRRRSSRLKQPKRPRQRTPKRVSRSSPKRYSELBasic
NLS Segment(s)
PositionSequence
154-181PRRRSSRLKQPKRPRQRTPKRVSRSSPK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038340  MRP-L47_sf  
IPR010729  Ribosomal_L47_mit  
Gene Ontology GO:0005761  C:mitochondrial ribosome  
GO:1990904  C:ribonucleoprotein complex  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF06984  MRP-L47  
Amino Acid Sequences MTLVREPVLDPKKRSKLRVDENHGLYQFFHSKEKAMNTPEEDNSHGRPWSAEELRHKSWEDLHSLWWVCCKERNRIATETHERERLDAGYGDYEAKARDVAVRRTQRAIKQVLTERYYSWEDARKLAAGDPEVDLSGEGPAHTPSLDAFELEEPRRRSSRLKQPKRPRQRTPKRVSRSSPKRYSELNGIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.7
3 0.72
4 0.76
5 0.81
6 0.8
7 0.79
8 0.77
9 0.78
10 0.69
11 0.58
12 0.48
13 0.42
14 0.38
15 0.31
16 0.29
17 0.23
18 0.25
19 0.28
20 0.33
21 0.34
22 0.32
23 0.34
24 0.35
25 0.39
26 0.39
27 0.37
28 0.36
29 0.33
30 0.32
31 0.31
32 0.26
33 0.22
34 0.2
35 0.21
36 0.26
37 0.25
38 0.27
39 0.33
40 0.4
41 0.42
42 0.45
43 0.43
44 0.36
45 0.38
46 0.36
47 0.32
48 0.26
49 0.25
50 0.27
51 0.26
52 0.25
53 0.24
54 0.23
55 0.19
56 0.24
57 0.26
58 0.3
59 0.36
60 0.4
61 0.4
62 0.42
63 0.44
64 0.46
65 0.51
66 0.49
67 0.44
68 0.43
69 0.39
70 0.36
71 0.35
72 0.27
73 0.2
74 0.15
75 0.13
76 0.09
77 0.1
78 0.09
79 0.08
80 0.08
81 0.07
82 0.06
83 0.06
84 0.05
85 0.09
86 0.12
87 0.17
88 0.25
89 0.3
90 0.31
91 0.35
92 0.39
93 0.39
94 0.41
95 0.4
96 0.34
97 0.34
98 0.39
99 0.41
100 0.39
101 0.36
102 0.31
103 0.31
104 0.31
105 0.27
106 0.23
107 0.24
108 0.23
109 0.24
110 0.24
111 0.2
112 0.19
113 0.2
114 0.19
115 0.13
116 0.13
117 0.13
118 0.12
119 0.11
120 0.11
121 0.09
122 0.07
123 0.07
124 0.06
125 0.05
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.1
133 0.1
134 0.09
135 0.1
136 0.13
137 0.18
138 0.2
139 0.27
140 0.25
141 0.3
142 0.33
143 0.34
144 0.39
145 0.44
146 0.54
147 0.58
148 0.67
149 0.73
150 0.82
151 0.9
152 0.95
153 0.95
154 0.95
155 0.95
156 0.95
157 0.95
158 0.95
159 0.94
160 0.92
161 0.92
162 0.89
163 0.89
164 0.89
165 0.88
166 0.88
167 0.82
168 0.78
169 0.73
170 0.69