Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D8N2

Protein Details
Accession A0A1B8D8N2   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-28QQFLELQKRKPKHEQKRSNIYVRRSNHydrophilic
NLS Segment(s)
PositionSequence
12-14KPK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEQQFLELQKRKPKHEQKRSNIYVRRSNESLSKPKNEQDKEQRRREAAEAGSQLKNLIEYLEACHTFSLALKVITDKSLSTQGYTYRPTIPSAHYALAQTSIRSTCFRLSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.84
4 0.84
5 0.9
6 0.9
7 0.89
8 0.85
9 0.81
10 0.79
11 0.72
12 0.69
13 0.59
14 0.53
15 0.5
16 0.5
17 0.53
18 0.49
19 0.5
20 0.46
21 0.5
22 0.57
23 0.53
24 0.55
25 0.56
26 0.62
27 0.66
28 0.72
29 0.71
30 0.63
31 0.63
32 0.56
33 0.5
34 0.41
35 0.36
36 0.3
37 0.29
38 0.28
39 0.25
40 0.23
41 0.17
42 0.16
43 0.1
44 0.08
45 0.05
46 0.05
47 0.06
48 0.09
49 0.1
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.1
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.11
62 0.11
63 0.09
64 0.1
65 0.15
66 0.15
67 0.15
68 0.16
69 0.19
70 0.22
71 0.25
72 0.25
73 0.23
74 0.24
75 0.26
76 0.27
77 0.26
78 0.27
79 0.28
80 0.27
81 0.24
82 0.24
83 0.22
84 0.24
85 0.22
86 0.18
87 0.18
88 0.18
89 0.19
90 0.2
91 0.22
92 0.21