Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8D5H1

Protein Details
Accession A0A1B8D5H1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80MIRSNRKKAAKAKLPSKKKAHydrophilic
NLS Segment(s)
PositionSequence
65-80NRKKAAKAKLPSKKKA
Subcellular Location(s) plas 21, E.R. 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLLVASAVFLYYSIWTLLMPFVDPDQPIQQLFPPRVWAIRIPVIIILLGSALVGSFLSIVMIRSNRKKAAKAKLPSKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.08
5 0.07
6 0.07
7 0.07
8 0.08
9 0.09
10 0.1
11 0.11
12 0.13
13 0.14
14 0.14
15 0.14
16 0.16
17 0.19
18 0.2
19 0.18
20 0.18
21 0.18
22 0.18
23 0.19
24 0.17
25 0.16
26 0.18
27 0.17
28 0.15
29 0.14
30 0.13
31 0.12
32 0.1
33 0.07
34 0.03
35 0.03
36 0.03
37 0.02
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.03
45 0.03
46 0.04
47 0.07
48 0.1
49 0.16
50 0.22
51 0.28
52 0.36
53 0.4
54 0.47
55 0.53
56 0.62
57 0.66
58 0.7
59 0.75
60 0.78