Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8DC43

Protein Details
Accession A0A1B8DC43    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-87FALSVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRNBasic
NLS Segment(s)
PositionSequence
58-87KRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MPVDAAPATETAQANRTYTATLTIEESTSRPSRDRMRERRLRYVEERAGGEMFALSVKRQRKLKMKKHKYKKLMRRTRNLRRRLDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.16
5 0.15
6 0.18
7 0.15
8 0.14
9 0.15
10 0.14
11 0.14
12 0.14
13 0.14
14 0.15
15 0.17
16 0.17
17 0.17
18 0.21
19 0.29
20 0.38
21 0.48
22 0.53
23 0.61
24 0.69
25 0.73
26 0.79
27 0.74
28 0.7
29 0.64
30 0.62
31 0.54
32 0.47
33 0.42
34 0.33
35 0.29
36 0.23
37 0.18
38 0.1
39 0.07
40 0.06
41 0.05
42 0.05
43 0.1
44 0.14
45 0.2
46 0.25
47 0.32
48 0.42
49 0.53
50 0.64
51 0.7
52 0.78
53 0.83
54 0.9
55 0.93
56 0.93
57 0.93
58 0.93
59 0.93
60 0.93
61 0.92
62 0.92
63 0.92
64 0.93
65 0.92
66 0.91
67 0.91