Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CRQ2

Protein Details
Accession A0A1B8CRQ2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
175-197GWQQGHRRRSREDGNKDRRHRSRBasic
NLS Segment(s)
PositionSequence
181-197RRRSREDGNKDRRHRSR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MFNTVKKWVDENPHRSNLKHVLGSAAVKAGGNHKGARGVWGKIQARDLGAMREIDDVPSRGISPSPSTPVGAFGYSSAPGGAPSYGGGSGGGEPYLGAQSGPSGYSYDNAAPASSYQASSGGGYQAQEPYQGGSYGGGYGGAPQPSYGGPGGPGGYPPQQSGGWQQGPPPPQQGGWQQGHRRRSREDGNKDRRHRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.61
3 0.63
4 0.6
5 0.56
6 0.49
7 0.41
8 0.35
9 0.35
10 0.36
11 0.29
12 0.21
13 0.16
14 0.14
15 0.14
16 0.16
17 0.17
18 0.19
19 0.19
20 0.19
21 0.22
22 0.22
23 0.28
24 0.27
25 0.25
26 0.26
27 0.34
28 0.36
29 0.34
30 0.36
31 0.32
32 0.29
33 0.3
34 0.27
35 0.2
36 0.18
37 0.16
38 0.15
39 0.16
40 0.15
41 0.13
42 0.14
43 0.13
44 0.12
45 0.13
46 0.12
47 0.1
48 0.11
49 0.11
50 0.13
51 0.14
52 0.17
53 0.18
54 0.18
55 0.17
56 0.19
57 0.19
58 0.15
59 0.13
60 0.1
61 0.11
62 0.1
63 0.1
64 0.07
65 0.06
66 0.06
67 0.07
68 0.06
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.05
77 0.05
78 0.04
79 0.03
80 0.03
81 0.04
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.06
93 0.07
94 0.07
95 0.08
96 0.08
97 0.08
98 0.07
99 0.07
100 0.09
101 0.09
102 0.08
103 0.07
104 0.08
105 0.08
106 0.09
107 0.09
108 0.07
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.09
117 0.09
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.06
125 0.05
126 0.06
127 0.09
128 0.09
129 0.08
130 0.08
131 0.09
132 0.09
133 0.12
134 0.1
135 0.08
136 0.08
137 0.09
138 0.1
139 0.09
140 0.1
141 0.11
142 0.14
143 0.15
144 0.15
145 0.17
146 0.16
147 0.18
148 0.22
149 0.27
150 0.27
151 0.27
152 0.3
153 0.32
154 0.35
155 0.36
156 0.36
157 0.29
158 0.26
159 0.31
160 0.34
161 0.37
162 0.41
163 0.47
164 0.52
165 0.58
166 0.67
167 0.69
168 0.68
169 0.65
170 0.68
171 0.7
172 0.71
173 0.75
174 0.76
175 0.8
176 0.86
177 0.88