Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YP90

Protein Details
Accession C7YP90    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
253-274SEIAAARERERRRRERQAAGPKBasic
NLS Segment(s)
PositionSequence
259-274RERERRRRERQAAGPK
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
KEGG nhe:NECHADRAFT_78676  -  
Amino Acid Sequences MASKTTFNNDEPLASIDFPGPYAATFYFNNDLAEEPDYLLSSDGGYLTDESDTSEEEEELPPESYMSEFPVVEDNPWPALSPSSTPSLTSSMQTQISSSDLEHSPKDQTDTSELSFTHVGSASSEIEVNTDGYVPFVEPSEGVVDDRTNQTFGASKAQSTTEKRSPAHFINFVDWKNPVPFEDFAKLSPQHRSEIRAIHWDSRLWFSTMFERGTPKYYQELARWRAARLRNIAGVPMDQKQADEIGYIMFRVSEIAAARERERRRRERQAAGPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.17
4 0.16
5 0.15
6 0.14
7 0.11
8 0.09
9 0.11
10 0.11
11 0.13
12 0.13
13 0.17
14 0.2
15 0.21
16 0.21
17 0.19
18 0.19
19 0.18
20 0.2
21 0.16
22 0.13
23 0.13
24 0.13
25 0.12
26 0.12
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.09
41 0.1
42 0.09
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.11
54 0.11
55 0.1
56 0.1
57 0.14
58 0.14
59 0.15
60 0.16
61 0.14
62 0.14
63 0.14
64 0.14
65 0.1
66 0.11
67 0.11
68 0.12
69 0.12
70 0.15
71 0.15
72 0.15
73 0.17
74 0.19
75 0.19
76 0.18
77 0.18
78 0.17
79 0.18
80 0.17
81 0.16
82 0.13
83 0.13
84 0.13
85 0.11
86 0.12
87 0.12
88 0.13
89 0.14
90 0.14
91 0.15
92 0.15
93 0.18
94 0.15
95 0.15
96 0.17
97 0.19
98 0.18
99 0.18
100 0.18
101 0.17
102 0.17
103 0.15
104 0.12
105 0.11
106 0.1
107 0.08
108 0.1
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.1
139 0.11
140 0.16
141 0.15
142 0.14
143 0.15
144 0.18
145 0.22
146 0.24
147 0.3
148 0.28
149 0.33
150 0.34
151 0.35
152 0.38
153 0.38
154 0.39
155 0.35
156 0.31
157 0.31
158 0.34
159 0.31
160 0.28
161 0.24
162 0.21
163 0.2
164 0.19
165 0.15
166 0.15
167 0.16
168 0.18
169 0.21
170 0.2
171 0.19
172 0.23
173 0.25
174 0.23
175 0.29
176 0.27
177 0.27
178 0.28
179 0.32
180 0.31
181 0.34
182 0.35
183 0.36
184 0.37
185 0.37
186 0.37
187 0.34
188 0.33
189 0.32
190 0.31
191 0.24
192 0.22
193 0.19
194 0.23
195 0.25
196 0.24
197 0.21
198 0.23
199 0.24
200 0.27
201 0.27
202 0.24
203 0.25
204 0.28
205 0.3
206 0.33
207 0.41
208 0.41
209 0.48
210 0.47
211 0.44
212 0.48
213 0.5
214 0.5
215 0.47
216 0.46
217 0.43
218 0.42
219 0.42
220 0.36
221 0.33
222 0.28
223 0.25
224 0.24
225 0.19
226 0.19
227 0.18
228 0.17
229 0.15
230 0.13
231 0.1
232 0.1
233 0.1
234 0.1
235 0.09
236 0.07
237 0.07
238 0.07
239 0.07
240 0.08
241 0.09
242 0.12
243 0.17
244 0.2
245 0.23
246 0.31
247 0.39
248 0.46
249 0.56
250 0.63
251 0.69
252 0.77
253 0.83
254 0.85