Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8CZ89

Protein Details
Accession A0A1B8CZ89    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
34-61EPTRVAPPTPKPKPRRRIPRPSLQNQYIHydrophilic
NLS Segment(s)
PositionSequence
41-53PTPKPKPRRRIPR
Subcellular Location(s) nucl 12, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MAAMAGAGAANVLETKGVDAVAKSEAPAAPAPTEPTRVAPPTPKPKPRRRIPRPSLQNQYIYAHPAPTLNSILAAEAARPVTAAEAEEVEIDWRLVAAAASKRGRNPSVTSNETALFTPAMSITCSASSSSIERAGTLLLLRRGPSRRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.08
8 0.1
9 0.1
10 0.09
11 0.12
12 0.12
13 0.13
14 0.15
15 0.15
16 0.14
17 0.15
18 0.19
19 0.18
20 0.21
21 0.19
22 0.21
23 0.23
24 0.24
25 0.26
26 0.28
27 0.35
28 0.42
29 0.51
30 0.58
31 0.64
32 0.72
33 0.8
34 0.84
35 0.87
36 0.86
37 0.88
38 0.86
39 0.87
40 0.87
41 0.85
42 0.83
43 0.75
44 0.68
45 0.59
46 0.53
47 0.43
48 0.37
49 0.29
50 0.2
51 0.17
52 0.15
53 0.13
54 0.13
55 0.13
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.07
62 0.05
63 0.05
64 0.05
65 0.04
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.06
85 0.08
86 0.14
87 0.17
88 0.19
89 0.21
90 0.26
91 0.28
92 0.28
93 0.3
94 0.32
95 0.37
96 0.4
97 0.39
98 0.37
99 0.36
100 0.34
101 0.3
102 0.23
103 0.16
104 0.12
105 0.1
106 0.09
107 0.08
108 0.08
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.11
115 0.12
116 0.13
117 0.15
118 0.17
119 0.16
120 0.16
121 0.16
122 0.15
123 0.14
124 0.14
125 0.17
126 0.17
127 0.19
128 0.2
129 0.27