Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZKQ4

Protein Details
Accession C7ZKQ4   
Localization Confidence High
Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-38LERKRVLDKISQRQKREKQKAFVRQSEKDHydrophilic
NLS Segment(s)
PositionSequence
12-27RKRVLDKISQRQKREK
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Gene Ontology GO:0016020  C:membrane  
KEGG nhe:NECHADRAFT_6075  -  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences KTRRRTSRQLERKRVLDKISQRQKREKQKAFVRQSEKDIHDARNEIERLRGVIQVMRVGSSRDACNINPVPLRPGSPHSGQVQHPVSMEPGPGAAPSPSAQEIKQPVIGCYCNPKTHKSYSDCFEQTVFDSLMTLNSNPTPIPPIPATPDIADLLFLRDPGDPVSEILYKLMRRPSMDNMVLLCAVYILAYRILRYRFFPSMKTYNDVPEWLRSTEFQDKIPHALYIDFVQFPRLRDAMVLGLVDIACIREDFDADFGRYLALDWPVSESFLITDSWRNTVLNPKFERIACTEESWSLSSSFGKKYPHLAPLVRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.73
3 0.71
4 0.7
5 0.7
6 0.73
7 0.73
8 0.75
9 0.79
10 0.84
11 0.86
12 0.87
13 0.86
14 0.85
15 0.87
16 0.9
17 0.89
18 0.89
19 0.86
20 0.79
21 0.77
22 0.75
23 0.67
24 0.63
25 0.58
26 0.52
27 0.48
28 0.45
29 0.4
30 0.4
31 0.38
32 0.31
33 0.3
34 0.28
35 0.26
36 0.26
37 0.26
38 0.18
39 0.2
40 0.2
41 0.2
42 0.19
43 0.18
44 0.17
45 0.17
46 0.18
47 0.19
48 0.18
49 0.18
50 0.21
51 0.19
52 0.27
53 0.27
54 0.3
55 0.29
56 0.29
57 0.29
58 0.28
59 0.3
60 0.24
61 0.27
62 0.27
63 0.27
64 0.3
65 0.3
66 0.34
67 0.32
68 0.38
69 0.36
70 0.33
71 0.31
72 0.27
73 0.25
74 0.21
75 0.2
76 0.12
77 0.09
78 0.08
79 0.08
80 0.08
81 0.06
82 0.07
83 0.07
84 0.09
85 0.11
86 0.12
87 0.12
88 0.17
89 0.2
90 0.2
91 0.24
92 0.22
93 0.2
94 0.23
95 0.23
96 0.19
97 0.24
98 0.26
99 0.28
100 0.3
101 0.35
102 0.36
103 0.42
104 0.49
105 0.45
106 0.47
107 0.44
108 0.5
109 0.45
110 0.41
111 0.35
112 0.28
113 0.24
114 0.22
115 0.19
116 0.11
117 0.1
118 0.09
119 0.1
120 0.1
121 0.09
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.1
128 0.1
129 0.13
130 0.12
131 0.13
132 0.16
133 0.17
134 0.18
135 0.15
136 0.16
137 0.13
138 0.12
139 0.12
140 0.08
141 0.09
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.07
150 0.07
151 0.1
152 0.09
153 0.09
154 0.1
155 0.12
156 0.11
157 0.14
158 0.17
159 0.16
160 0.17
161 0.2
162 0.24
163 0.29
164 0.29
165 0.27
166 0.24
167 0.23
168 0.21
169 0.18
170 0.13
171 0.06
172 0.05
173 0.04
174 0.04
175 0.03
176 0.06
177 0.06
178 0.07
179 0.1
180 0.12
181 0.13
182 0.16
183 0.2
184 0.24
185 0.26
186 0.28
187 0.31
188 0.36
189 0.37
190 0.38
191 0.34
192 0.32
193 0.31
194 0.31
195 0.26
196 0.23
197 0.24
198 0.21
199 0.21
200 0.18
201 0.23
202 0.3
203 0.29
204 0.28
205 0.3
206 0.3
207 0.33
208 0.33
209 0.27
210 0.2
211 0.19
212 0.17
213 0.14
214 0.15
215 0.13
216 0.12
217 0.16
218 0.17
219 0.19
220 0.22
221 0.2
222 0.18
223 0.17
224 0.19
225 0.15
226 0.15
227 0.13
228 0.08
229 0.09
230 0.09
231 0.08
232 0.07
233 0.06
234 0.05
235 0.05
236 0.06
237 0.05
238 0.06
239 0.07
240 0.1
241 0.12
242 0.13
243 0.13
244 0.12
245 0.12
246 0.12
247 0.12
248 0.11
249 0.11
250 0.1
251 0.1
252 0.14
253 0.14
254 0.15
255 0.14
256 0.12
257 0.1
258 0.11
259 0.12
260 0.09
261 0.14
262 0.15
263 0.18
264 0.19
265 0.19
266 0.2
267 0.29
268 0.34
269 0.38
270 0.4
271 0.41
272 0.45
273 0.45
274 0.48
275 0.42
276 0.41
277 0.35
278 0.34
279 0.33
280 0.3
281 0.32
282 0.29
283 0.27
284 0.22
285 0.2
286 0.21
287 0.23
288 0.25
289 0.27
290 0.3
291 0.31
292 0.37
293 0.42
294 0.44
295 0.47