Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8D023

Protein Details
Accession A0A1B8D023   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
70-96STPRTPKTPKTPASRKPKKLDNNVDDEHydrophilic
NLS Segment(s)
PositionSequence
76-88KTPKTPASRKPKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MPSPWTPEADRDLLLAIIDENKLQGLDWRVIAAKMATKNENYSFSHEGCRQHFQKLRKASNTGANGSAPSTPRTPKTPKTPASRKPKKLDNNVDDEEAEDFATPSKKRKRDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.09
4 0.08
5 0.08
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.1
12 0.12
13 0.13
14 0.13
15 0.14
16 0.15
17 0.15
18 0.15
19 0.12
20 0.13
21 0.15
22 0.18
23 0.19
24 0.19
25 0.23
26 0.24
27 0.27
28 0.24
29 0.27
30 0.27
31 0.26
32 0.3
33 0.3
34 0.31
35 0.3
36 0.36
37 0.31
38 0.35
39 0.4
40 0.4
41 0.44
42 0.49
43 0.52
44 0.49
45 0.51
46 0.46
47 0.48
48 0.46
49 0.4
50 0.32
51 0.26
52 0.23
53 0.21
54 0.2
55 0.14
56 0.13
57 0.14
58 0.15
59 0.18
60 0.24
61 0.3
62 0.35
63 0.43
64 0.51
65 0.56
66 0.64
67 0.71
68 0.74
69 0.79
70 0.83
71 0.83
72 0.81
73 0.83
74 0.83
75 0.84
76 0.86
77 0.81
78 0.78
79 0.72
80 0.66
81 0.56
82 0.47
83 0.37
84 0.26
85 0.2
86 0.12
87 0.09
88 0.1
89 0.16
90 0.16
91 0.25
92 0.34