Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z6Q1

Protein Details
Accession C7Z6Q1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-98ASRTTSRSKFGTKKPKKATVGHydrophilic
NLS Segment(s)
PositionSequence
90-94KKPKK
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG nhe:NECHADRAFT_90799  -  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MGVCLRVGVVRPKKPNSGERKTARIKLSTGALITAYIPGEGHNIQQHSVVLVRGGRAQDCPGVRYRLIRGALDLGGVASRTTSRSKFGTKKPKKATVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.68
4 0.68
5 0.7
6 0.68
7 0.72
8 0.72
9 0.72
10 0.67
11 0.59
12 0.52
13 0.45
14 0.42
15 0.34
16 0.27
17 0.21
18 0.17
19 0.14
20 0.13
21 0.11
22 0.07
23 0.06
24 0.05
25 0.05
26 0.07
27 0.07
28 0.09
29 0.1
30 0.11
31 0.11
32 0.12
33 0.11
34 0.1
35 0.1
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.09
42 0.09
43 0.09
44 0.1
45 0.13
46 0.13
47 0.15
48 0.16
49 0.19
50 0.19
51 0.21
52 0.23
53 0.25
54 0.27
55 0.25
56 0.23
57 0.22
58 0.21
59 0.19
60 0.16
61 0.1
62 0.08
63 0.08
64 0.06
65 0.05
66 0.05
67 0.08
68 0.13
69 0.14
70 0.18
71 0.22
72 0.32
73 0.4
74 0.5
75 0.59
76 0.65
77 0.75
78 0.8