Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NB19

Protein Details
Accession A0A1B7NB19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRNSKPVKLRRGLRKHVKVNSDAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18, mito 9, cyto_nucl 9, cyto_pero 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MRNSKPVKLRRGLRKHVKVNSDAITCIDISTDNKLLASGSWDNTFDASTLETVSAPFEGHSKAIYGLALSLNSAILVSDSEDGTIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.85
4 0.81
5 0.73
6 0.68
7 0.63
8 0.53
9 0.43
10 0.35
11 0.28
12 0.22
13 0.19
14 0.13
15 0.09
16 0.09
17 0.12
18 0.12
19 0.11
20 0.11
21 0.11
22 0.11
23 0.09
24 0.13
25 0.1
26 0.1
27 0.11
28 0.12
29 0.12
30 0.12
31 0.12
32 0.08
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.09
51 0.08
52 0.07
53 0.07
54 0.08
55 0.08
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.04
63 0.04
64 0.06
65 0.07
66 0.07
67 0.08